Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 2 publications below |
Product Information
67591-1-Ig targets PHGDH in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6877 Product name: Recombinant human PHGDH protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 186-533 aa of BC000303 Sequence: FGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF 相同性解析による交差性が予測される生物種 |
| Full Name | phosphoglycerate dehydrogenase |
| Calculated molecular weight | 57 kDa |
| Observed molecular weight | 57 kDa |
| GenBank accession number | BC000303 |
| Gene Symbol | PHGDH |
| Gene ID (NCBI) | 26227 |
| RRID | AB_2882799 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O43175 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PHGDH(D-3-phosphoglycerate dehydrogenase) is also named as 3-PGDH, PGDH3 and belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. It catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor. 3-PGDH deficiency is a rare recessive inborn error in the biosynthesis of the amino acid L-serine characterized clinically by congenital microcephaly, psychomotor retardation, and intractable seizures(PMID:19235232 ).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PHGDH antibody 67591-1-Ig | Download protocol |
| IF protocol for PHGDH antibody 67591-1-Ig | Download protocol |
| IHC protocol for PHGDH antibody 67591-1-Ig | Download protocol |
| IP protocol for PHGDH antibody 67591-1-Ig | Download protocol |
| WB protocol for PHGDH antibody 67591-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell The long noncoding RNA glycoLINC assembles a lower glycolytic metabolon to promote glycolysis. | ||
Adv Sci (Weinh) RFWD3 Reprograms Nucleotide Metabolism Through PHGDH to Induce Chemoresistance In Osteosarcoma | ||
PLoS Comput Biol Co-morbid biomarkers for sarcopenic obesity associated with gut microbiota metabolites: From burden to treatment. | ||
Int Immunopharmacol Artesunate attenuates serum amyloid A-induced M1 macrophage differentiation through the promotion of PHGDH | ||
Oncogene Interaction of PHGDH with IGF2BP1 facilitates m6A-dependent stabilization of TCF7L2 mRNA to confer multidrug resistance in gastric cancer | ||
Redox Biol XPR1 downregulation inhibits hepatocellular carcinoma progression by suppressing serine metabolism. |




