Validation Data Gallery
Tested Applications
| Positive WB detected in | NCI-H1299 cells, HeLa cells, U2OS cells, HepG2 cells, PC-3 cells, SKOV-3 cells, A2780 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, Calu-1 cells, Caco-2 cells, Caki-1 cells, MCF-10A cells, LNCaP cells, SK-N-SH cells |
| Positive IHC detected in | human colon cancer tissue, human colon tissue, human hysteromyoma tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
66693-1-Ig targets Caldesmon in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, monkey |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13676 Product name: Recombinant human CALD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 196-538 aa of BC040354 Sequence: EKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV 相同性解析による交差性が予測される生物種 |
| Full Name | caldesmon 1 |
| Calculated molecular weight | 538 aa, 63 kDa |
| Observed molecular weight | 70 kDa~75 kDa |
| GenBank accession number | BC040354 |
| Gene Symbol | CALD1 |
| Gene ID (NCBI) | 800 |
| RRID | AB_2882047 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q05682 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Caldesmon (CALD1), a protein found in the cytoskeleton, plays an important role in proliferation, apoptosis, cell motility, adhesion, receptor function, and second messenger pathways. Caldesmon is a substrate of cdc2 kinase and Erk1/2 MAPK, and phosphorylation by either of these kinases reverses the inhibitory effects of caldesmon. Caldesmon(CALD1) is a prognostic biomarker and correlated with bladder cancer(PMID: 34733993) and immune infiltrates in gastric cancers(PMID: 34189308).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Caldesmon antibody 66693-1-Ig | Download protocol |
| IF protocol for Caldesmon antibody 66693-1-Ig | Download protocol |
| IHC protocol for Caldesmon antibody 66693-1-Ig | Download protocol |
| WB protocol for Caldesmon antibody 66693-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Mol Sci Changes in the Expression of Smooth Muscle Cell-Related Genes in Human Dermal Sheath Cup Cells Associated with the Treatment Outcome of Autologous Cell-Based Therapy for Male and Female Pattern Hair Loss. | ||
Int J Clin Pract GPX3-Mediated Oxidative Stress Affects Pyrimidine Metabolism Levels in Stomach Adenocarcinoma via the AMPK/mTOR Pathway | ||
Sci Rep Cell-specific α and β subunit expression patterns of Na+/K+-ATPases in the common marmoset cochlea | ||
Sci Rep Distinct Connexin43, Connexin31, and Pannexin1 expression patterns in the cochlea of a non-human primate. | ||
Placenta Endothelin-1 potentiated constriction in preeclampsia placental veins: Role of ETAR/ETBR/CaV1.2/CALD1 |












