Validation Data Gallery
Tested Applications
| Positive IF/ICC detected in | Tunicamycin treated HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.60 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IF | See 3 publications below |
Product Information
FITC-10835 targets ATF4 in WB, IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1279 Product name: Recombinant human ATF4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC022088 Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP 相同性解析による交差性が予測される生物種 |
| Full Name | activating transcription factor 4 (tax-responsive enhancer element B67) |
| Calculated molecular weight | 39 kDa |
| Observed molecular weight | 45-50 kDa |
| GenBank accession number | BC022088 |
| Gene Symbol | ATF4 |
| Gene ID (NCBI) | 468 |
| RRID | AB_2883737 |
| Conjugate | FITC Fluorescent Dye |
| Excitation/Emission maxima wavelengths | 498 nm / 526 nm |
| 激发激光 | Blue laser (488 nm) |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P18848 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
What is the molecular weight of ATF4?
The molecular weight of ATF4 is 45-50 kD.
What is ATF4?
Activating transcription factor 4 (ATF4), also known as cAMP-response element-binding protein 2 (CREB2), is a substrate of RSK2 and a basic leucine-zipper transcription factor (PMIDs: 16000305, 17485283).
What the function of ATF4?
ATF4 its a transcription factor that controls the transcriptional activity of mature osteoblasts. ATF4 is particularly critical for their timely onset and terminal differentiation, as well as expression of Bsp and osteocalcin. Knockout animals displayed reduction or delay in bone mineralization and have severely reduced bone volume. ATF4 is also part of the PERK-eIF2α-ATF4-CHOP apoptosis pathway, which is activated by ER stress, and it likely plays a role related to tumor cell survival (PMIDs: 18083928, 16000305, 30134550).
What is the effect of ATF4 interaction with RSK2?
ATF4 and RSK2 posttranscriptionally regulate type I collagen synthesis. Lack of RSK2 phosphorylation of AFT4 may contribute to skeletal phenotypes associated with Coffin-Lowry Syndrome (PMID: 17485283).
Where is ATF4 expressed?
ATF4 protein is predominantly expressed in osteoblasts, although its corresponding Atf4 mRNA is ubiquitously expressed (PMID: 16000305).
What regulates ATF4 expression?
ATF4 is regulated by a ubiquitin/proteasomal pathway, which is less active in osteoblasts by inhibition with MG115 (PMID: 16000305).
How does ATF4 expression affect Ocn mRNA?
Inhibition of the degradation pathway leads to ATF4 accumulation and induces Ocn mRNA expression in non-osteoblastic cells (PMID: 16000305).
Does ATF4 have the ability to induce osteoblast-specific gene expression even in non-osteoblastic cells?
Yes, ATF4, as well as other osteoblast differentiation factors, has this ability. AFT4 interactions with Runx2 can stimulate osteoblast-specific osteocalcin gene expression. (PMIDs: 16000305, 17485283)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FITC ATF4 antibody FITC-10835 | Download protocol |
| IF protocol for FITC ATF4 antibody FITC-10835 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Oxid Med Cell Longev Protocatechuic Acid-Mediated miR-219a-5p Activation Inhibits the p66shc Oxidant Pathway to Alleviate Alcoholic Liver Injury. | ||
Cancer Cell Int MiR-876-5p modulates head and neck squamous cell carcinoma metastasis and invasion by targeting vimentin. | ||
Mol Med Rep Molecular mechanism underlying miR‑130b‑Sp1 transcriptional regulation in LPS‑induced upregulation of MUC5AC in the bile duct epithelium. | ||
Front Pharmacol Polydatin enhances oxaliplatin-induced cell death by activating NOX5-ROS-mediated DNA damage and ER stress in colon cancer cells | ||
Asian J Pharm Sci Light-stimulated smart thermo-responsive constructs for enhanced wound healing: A streamlined command approach | ||
Int J Nanomedicine Nanoparticle/Engineered Bacteria Based Triple-Strategy Delivery System for Enhanced Hepatocellular Carcinoma Cancer Therapy |


