Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, rat brain tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue, human placenta tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Tunicamycin treated HeLa cells, HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 27 publications below |
| WB | See 446 publications below |
| IHC | See 40 publications below |
| IF | See 30 publications below |
| IP | See 5 publications below |
| CoIP | See 1 publications below |
| ChIP | See 6 publications below |
Product Information
10835-1-AP targets ATF4 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, zebrafish, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1279 Product name: Recombinant human ATF4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC022088 Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP 相同性解析による交差性が予測される生物種 |
| Full Name | activating transcription factor 4 (tax-responsive enhancer element B67) |
| Calculated molecular weight | 39 kDa |
| Observed molecular weight | 45-50 kDa |
| GenBank accession number | BC022088 |
| Gene Symbol | ATF4 |
| Gene ID (NCBI) | 468 |
| RRID | AB_2058600 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P18848 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
What is the molecular weight of ATF4?
The molecular weight of ATF4 is 45-50 kD.
What is ATF4?
Activating transcription factor 4 (ATF4), also known as cAMP-response element-binding protein 2 (CREB2), is a substrate of RSK2 and a basic leucine-zipper transcription factor (PMIDs: 16000305, 17485283).
What the function of ATF4?
ATF4 its a transcription factor that controls the transcriptional activity of mature osteoblasts. ATF4 is particularly critical for their timely onset and terminal differentiation, as well as expression of Bsp and osteocalcin. Knockout animals displayed reduction or delay in bone mineralization and have severely reduced bone volume. ATF4 is also part of the PERK-eIF2α-ATF4-CHOP apoptosis pathway, which is activated by ER stress, and it likely plays a role related to tumor cell survival (PMIDs: 18083928, 16000305, 30134550).
What is the effect of ATF4 interaction with RSK2?
ATF4 and RSK2 posttranscriptionally regulate type I collagen synthesis. Lack of RSK2 phosphorylation of AFT4 may contribute to skeletal phenotypes associated with Coffin-Lowry Syndrome (PMID: 17485283).
Where is ATF4 expressed?
ATF4 protein is predominantly expressed in osteoblasts, although its corresponding Atf4 mRNA is ubiquitously expressed (PMID: 16000305).
What regulates ATF4 expression?
ATF4 is regulated by a ubiquitin/proteasomal pathway, which is less active in osteoblasts by inhibition with MG115 (PMID: 16000305).
How does ATF4 expression affect Ocn mRNA?
Inhibition of the degradation pathway leads to ATF4 accumulation and induces Ocn mRNA expression in non-osteoblastic cells (PMID: 16000305).
Does ATF4 have the ability to induce osteoblast-specific gene expression even in non-osteoblastic cells?
Yes, ATF4, as well as other osteoblast differentiation factors, has this ability. AFT4 interactions with Runx2 can stimulate osteoblast-specific osteocalcin gene expression. (PMIDs: 16000305, 17485283)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ATF4 antibody 10835-1-AP | Download protocol |
| IHC protocol for ATF4 antibody 10835-1-AP | Download protocol |
| IP protocol for ATF4 antibody 10835-1-AP | Download protocol |
| WB protocol for ATF4 antibody 10835-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Targeting Mitochondria-Located circRNA SCAR Alleviates NASH via Reducing mROS Output. | ||
Cell Metab AIDA Selectively Mediates Downregulation of Fat Synthesis Enzymes by ERAD to Retard Intestinal Fat Absorption and Prevent Obesity. | ||
Nat Commun Investigational eIF2B activator DNL343 modulates the integrated stress response in preclinical models of TDP-43 pathology and individuals with ALS in a randomized clinical trial |












