Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, K-562 cells, mouse liver tissue, 3T3-L1 cells, NIH/3T3 cells, rat liver tissue |
| Positive IHC detected in | human liver cancer tissue, human renal cell carcinoma tissue, human liver tissue, human colon cancer tissue, human prostate cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | oleic acid treated HeLa cells |
This antibody is not suitable for immunofluorescence staining of frozen sections.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 120 publications below |
| IHC | See 32 publications below |
| IF | See 76 publications below |
| IP | See 1 publications below |
Product Information
15294-1-AP targets Perilipin-2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, monkey, zebrafish, bovine, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7539 Product name: Recombinant human ADRP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 88-437 aa of BC005127 Sequence: DRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH 相同性解析による交差性が予測される生物種 |
| Full Name | adipose differentiation-related protein |
| Calculated molecular weight | 48 kDa |
| Observed molecular weight | 45-48 kDa |
| GenBank accession number | BC005127 |
| Gene Symbol | Perilipin-2 |
| Gene ID (NCBI) | 123 |
| RRID | AB_2878122 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99541 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ADRP (adipocyte differentiation related protein) also known as ADFP, adipophilin, or perilipin-2, is a member of PAT family which is responsible for the transportation of lipids and the formation of lipid droplets. ADRP is localized on the surface of lipid droplets in a variety of tissues and cell lines. ADRP is not detected in undifferentiated cells but increases rapidly to high levels when adipocyte precursors differentiate into adipocytes. Anti-ADRP antibody is a reliable and sensitive marker for lipid droplet. Enhanced expression of ADRP is linked to diseases with abnormal lipid storage, including hepatic steatosis, atherosclerosis and diabetes. Immunohistochemistry of ADRP may facilitate histomorphological diagnosis of these diseases. This antibody is not suitable for immunofluorescence staining of frozen sections.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Perilipin-2 antibody 15294-1-AP | Download protocol |
| IHC protocol for Perilipin-2 antibody 15294-1-AP | Download protocol |
| WB protocol for Perilipin-2 antibody 15294-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature iPS-cell-derived microglia promote brain organoid maturation via cholesterol transfer | ||
Signal Transduct Target Ther The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease | ||
Cell Metab Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism. | ||
Nat Commun Spliceosome component Usp39 contributes to hepatic lipid homeostasis through the regulation of autophagy | ||
Brain Behav Immun HIV-TAT dysregulates microglial lipid metabolism through SREBP2/miR-124 axis: Implication of lipid droplet accumulation microglia in NeuroHIV |

















