Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, NIH/3T3 cells, HSC-T6 cells, K-562 cells, Jurkat cells, HEK-293 cells |
| Positive IHC detected in | human tonsillitis tissue, rat skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HT-29 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 29 publications below |
| IF | See 1 publications below |
Product Information
67686-1-Ig targets cyclin B1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29444 Product name: Recombinant human CCNB1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-140 aa of BC006510 Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE 相同性解析による交差性が予測される生物種 |
| Full Name | cyclin B1 |
| Calculated molecular weight | 48 kDa |
| Observed molecular weight | 55 kDa |
| GenBank accession number | BC006510 |
| Gene Symbol | Cyclin B1 |
| Gene ID (NCBI) | 891 |
| RRID | AB_2882879 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P14635 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for cyclin B1 antibody 67686-1-Ig | Download protocol |
| IHC protocol for cyclin B1 antibody 67686-1-Ig | Download protocol |
| WB protocol for cyclin B1 antibody 67686-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer | ||
Ecotoxicol Environ Saf The role of ER stress and ATP/AMPK in oxidative stress meditated hepatotoxicity induced by citrinin. | ||
Cell Signal MicroRNA-30c-5p arrests bladder cancer G2/M phase and suppresses its progression by targeting PRC1-mediated blocking of CDK1/Cyclin B1 axis | ||
Front Mol Biosci Over-Expression and Prognostic Significance of FATP5, as a New Biomarker, in Colorectal Carcinoma. | ||
Steroids The location of estrogen receptor variant ER-α36 is associated with the invasion of glioblastoma | ||
Cell Biochem Biophys Brucine Suppresses Malignant Progression of Prostate Cancer by Decreasing Sarcosine Accumulation via Downregulation of GNMT in the Glycine/sarcosine Metabolic Pathway |








