Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, HepG2 cells, Hela cells, Jurkat cells, HSCT6 cells, pig brain tissue, rat brain tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | human spleen tissue, human tonsillitis tissue, human lung cancer tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
66626-1-Ig targets cIAP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21398 Product name: Recombinant human cIAP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 95-196 aa of BC016174 Sequence: LGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPL 相同性解析による交差性が予測される生物種 |
| Full Name | baculoviral IAP repeat-containing 2 |
| Calculated molecular weight | 618 aa, 70 kDa |
| Observed molecular weight | 70 kDa |
| GenBank accession number | BC016174 |
| Gene Symbol | cIAP1 |
| Gene ID (NCBI) | 329 |
| RRID | AB_2881986 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q13490 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
BIRC2 (also known as cIAP1) is a member of the inhibitor of apoptosis protein (IAP) family. The inhibitor of apoptosis (IAP) proteins are a family of anti-apoptotic regulators found in viruses and metazoans. BIRC2 is a nuclear shuttling protein, whose subcellular localization is mediated by the CRM1-dependent nuclear export pathway (PMID: 15265700). The protein is regulated transcriptionally and can be inhibited by mitochondrial proteins released in the cytoplasm upon apoptotic stimuli (PMID: 15187025). BIRC2 is also believed to be a critical regulator of vascular integrity and endothelial cell survival, thereby providing an additional target pathway for the control of angiogenesis and blood vessel homeostasis during embryogenesis, regeneration and tumorigenesis (PMID: 17934460).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for cIAP1 antibody 66626-1-Ig | Download protocol |
| IHC protocol for cIAP1 antibody 66626-1-Ig | Download protocol |
| WB protocol for cIAP1 antibody 66626-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Dis Cellular FLICE-like inhibitory protein (cFLIP) critically maintains apoptotic resistance in human lens epithelial cells. | ||
bioRxiv Epstein-Barr Virus Latent Membrane Protein 1 targets cIAP1, cIAP2 and TRAF2 for Proteasomal Degradation to Activate the Non-canonical NF-κB Pathway | ||
J Exp Clin Cancer Res TRIM56 promotes malignant progression of glioblastoma by stabilizing cIAP1 protein | ||
JCI Insight Insights into absence of lymphoma despite fulminant Epstein-Barr virus infection in patients with XIAP deficiency | ||
Mol Cell Palmitoylation licenses RIPK1 kinase activity and cytotoxicity in the TNF pathway | ||
Br J Cancer High expression of the cachexia-related protein Fn14 in esophageal squamous cell carcinoma correlates with poor chemotherapy response and anti-Fn14 therapy decreases chemotherapeutic resistance |












