Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, Jurkat cells, SKOV-3 cells, HepG2 cells |
| Positive IHC detected in | human colon cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below |
| IF | See 1 publications below |
Product Information
66279-1-Ig targets ZEB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17118 Product name: Recombinant human ZEB1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 391-740 aa of BC112392 Sequence: MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSL 相同性解析による交差性が予測される生物種 |
| Full Name | zinc finger E-box binding homeobox 1 |
| Calculated molecular weight | 1125 aa, 124 kDa |
| Observed molecular weight | 190-210 kDa |
| GenBank accession number | BC112392 |
| Gene Symbol | ZEB1 |
| Gene ID (NCBI) | 6935 |
| RRID | AB_2881662 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P37275 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ZEB1(zinc-finger-enhancer binding protein 1), which is a member of the Zinc finger-Homeobox (ZFH) family of repressors, acts as a transcriptional repressor that inhibits interleukin-2 (IL-2) gene expression. Depending on the quantity of cDNA and on the cell type, ZEB1 can enhance or repress the promoter activity of the ATP1A1 gene. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. The calculated molecular weight of ZEB1 is 124 kDa, but the post-phosphorylation of protein is about 190-210 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ZEB1 antibody 66279-1-Ig | Download protocol |
| IHC protocol for ZEB1 antibody 66279-1-Ig | Download protocol |
| WB protocol for ZEB1 antibody 66279-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Theranostics FSH induces EMT in ovarian cancer via ALKBH5-regulated Snail m6A demethylation | ||
Biochim Biophys Acta Mol Cell Res The calcium pump PMCA4 prevents epithelial-mesenchymal transition by inhibiting NFATc1-ZEB1 pathway in gastric cancer. | ||
Breast Cancer Overexpression of SERPINA3 promotes tumor invasion and migration, epithelial-mesenchymal-transition in triple-negative breast cancer cells. | ||
J Clin Med A Mutation in ZNF143 as a Novel Candidate Gene for Endothelial Corneal Dystrophy. | ||
Cancer Gene Ther Loss of exosomal miR-200b-3p from hypoxia cancer-associated fibroblasts promotes tumorigenesis and reduces sensitivity to 5-Flourouracil in colorectal cancer via upregulation of ZEB1 and E2F3 | ||
J Biol Chem The aryl sulfonamide indisulam inhibits gastric cancer cell migration by promoting the ubiquitination and degradation of the transcription factor ZEB1 |










