Validation Data Gallery
Tested Applications
| Positive WB detected in | rat skeletal muscle tissue, A549 cells, HeLa cells, HepG2 cells, mouse skeletal muscle tissue, rabbit skeletal muscle tissue, rat heart tissue, mouse heart tissue, rabbit heart tissue, HT-29 cells, human heart tissue, pig heart tissue |
| Positive IHC detected in | mouse heart tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
67244-1-Ig targets TPM4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6947 Product name: Recombinant human TPM4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-248 aa of BC037576 Sequence: MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI 相同性解析による交差性が予測される生物種 |
| Full Name | tropomyosin 4 |
| Calculated molecular weight | 248 aa, 29 kDa |
| Observed molecular weight | 32-35 kDa |
| GenBank accession number | BC037576 |
| Gene Symbol | TPM4 |
| Gene ID (NCBI) | 7171 |
| ENSEMBL Gene ID | ENSG00000167460 |
| RRID | AB_2882523 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P67936 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TPM4 is a member of tropomyosins (TPMs), a multi-gene family of actin-binding proteins present in all eukaryotic cells. In muscle, TPMs are responsible for mediating contraction via regulation of the actin-myosin interaction. As to non-muscle cells, its proposed role is to stabilize the actin filaments by modulating the interaction with proteins that are responsible for the regulation of actin dynamics. The form of TPM4 in muscle has a higher molecular weight than the form found in non-muscle cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TPM4 antibody 67244-1-Ig | Download protocol |
| IHC protocol for TPM4 antibody 67244-1-Ig | Download protocol |
| WB protocol for TPM4 antibody 67244-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
CNS Neurosci Ther Plasma-Derived Exosomal i-tRF-LeuCAA as Biomarker for Glioma Diagnosis and Promoter of Epithelial-Mesenchymal Transition via TPM4 Regulation | ||
PLoS One Proteomic changes in the hippocampus of large mammals after total-body low dose radiation | ||
Clin Exp Med TPM4 influences the initiation and progression of gastric cancer by modulating ferroptosis via SCD1 | ||
Cell Discov TPM4 condensates glycolytic enzymes and facilitates actin reorganization under hyperosmotic stress | ||
J Cancer Hypoxia upregulate TPM4 expression to strengthen epithelial-mesenchymal transition that promotes lymph node metastasis of papillary thyroid cancer.
| ||
Cell Death Discov Zona pellucida is required for oocyte actin cortex and oocyte-somatic cell interactions during oocyte growth. |






