Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, A549 cells, 4T1 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 9 publications below |
| IHC | See 4 publications below |
| IF | See 3 publications below |
Product Information
14236-1-AP targets SLC39A6/ZIP6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5478 Product name: Recombinant human SLC39A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 101-283 aa of BC039498 Sequence: HLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHH 相同性解析による交差性が予測される生物種 |
| Full Name | solute carrier family 39 (zinc transporter), member 6 |
| Calculated molecular weight | 85 kDa |
| Observed molecular weight | 85-103 kDa, 48 and 32 kDa |
| GenBank accession number | BC039498 |
| Gene Symbol | SLC39A6/ZIP6 |
| Gene ID (NCBI) | 25800 |
| RRID | AB_10596924 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13433 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The zinc transporter LIV-1 (also known as SLC39A6 or ZIP6) was originally identified as an estrogen-induced gene in breast cancer cells. Elevated LIV-1 expression is reportedly related to cancer progression in various types of cancer, including breast, prostate, pancreatic, cervical and liver cancers. While correlation of LIV-1 and prognosis may vary. LIV 1 has 3 isoforms with MW of 85-100 (glycosylation and phosphorylation), 48 and 32 kDa while migrates as different bands in different lysates in SDS-PAGE. Furthermore, it has been reported in the papers that full-length SLC39A6/ZIP6, as the pro-protein, is predicted to be 85 kDa and produces a 103 kDa band, the N-terminal fragment after cleavage is 35 kDa, and the cleaved ZIP6 is 68 kDa (PMID: 23919497, PMID: 26444413).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC39A6/ZIP6 antibody 14236-1-AP | Download protocol |
| WB protocol for SLC39A6/ZIP6 antibody 14236-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Genet Genome-wide association study identifies common variants in SLC39A6 associated with length of survival in esophageal squamous-cell carcinoma.
| ||
Bioact Mater Mechanism and regulatory strategy study on promoting vascularized bone regeneration via intracellular zinc ion transport | ||
Gastroenterology Solute Carrier Family 39 Member 6 Gene Promotes Aggressiveness of Esophageal Carcinoma Cells by Increasing Intracellular Levels of Zinc, Activating Phosphatidylinositol 3-Kinase Signaling, and Up-regulating Genes That Regulate Metastasis.
| ||
Oncotarget miR-192, a prognostic indicator, targets the SLC39A6/SNAIL pathway to reduce tumor metastasis in human hepatocellular carcinoma. | ||
Oncotarget Co-expression analysis revealed PTCH1-3'UTR promoted cell migration and invasion by activating miR-101-3p/SLC39A6 axis in non-small cell lung cancer: implicating the novel function of PTCH1.
|





