Validation Data Gallery
Tested Applications
| Positive WB detected in | rabbit brain tissue, rat brain tissue, rat cerebellum tissue, rat spinal cord tissue |
| Positive IHC detected in | rat brain tissue, human appendicitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 3 publications below |
| IF | See 14 publications below |
Product Information
66616-1-Ig targets S100B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7440 Product name: Recombinant human S100B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC001766 Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE 相同性解析による交差性が予測される生物種 |
| Full Name | S100 calcium binding protein B |
| Calculated molecular weight | 11 kDa |
| Observed molecular weight | 11 kDa |
| GenBank accession number | BC001766 |
| Gene Symbol | S100 Beta |
| Gene ID (NCBI) | 6285 |
| RRID | AB_2881976 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P04271 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
S100B is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs and has been implicated in the regulation of cellular activities such as metabolism, motility and proliferation. In the nervous system, S100B is constitutively released by astrocytes into the extracellular space and at nanomolar concentrations, it can promote neurite outgrowth and protect neurons against oxidative stress. Within the central nervous system (CNS), S100B is thought to be a marker for astroglial activation, linking astrocyte dysfunction to schizophrenia. In addition to astrocytes, S100B is released from many cell types, such as, adipocytes, chondrocytes, cardiomyocytes and lymphocytes. Serum S100B represents a new biomarker for mood disorders.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for S100B antibody 66616-1-Ig | Download protocol |
| IHC protocol for S100B antibody 66616-1-Ig | Download protocol |
| WB protocol for S100B antibody 66616-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Acta Neuropathol Commun Repetitive mild TBI causes pTau aggregation in nigra without altering preexisting fibril induced Parkinson’s-like pathology burden | ||
ACS Omega Platelet-Rich Plasma Gel-Loaded Collagen/Chitosan Composite Film Accelerated Rat Sciatic Nerve Injury Repair | ||
Front Neurosci Nogo-C Inhibits Peripheral Nerve Regeneration by Regulating Schwann Cell Apoptosis and Dedifferentiation. | ||
Transl Oncol High throughput proteomic and metabolic profiling identified target correction of metabolic abnormalities as a novel therapeutic approach in head and neck paraganglioma. | ||
Bioact Mater Advanced nerve regeneration enabled by neural conformal electronic stimulators enhancing mitochondrial transport | ||
J Adv Res S100B induces angiogenesis via the clathrin/FOXO1/β-catenin signaling pathway and contributes to Bevacizumab resistance in epithelial ovarian cancer |







