Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, human brain tissue, NIH/3T3 cells, HeLa cells, HUVEC cells, HL-60 cells, HSC-T6 cells, RAW 264.7 cells |
| Positive IP detected in | HL-60 cells, HSC-T6 cells, Raw 264.7 cells, HUVEC cells, HL-60 cells, NIH/3T3 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 40 publications below |
| IHC | See 4 publications below |
| IF | See 10 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
66122-1-Ig targets RAC1 in WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17779 Product name: Recombinant human RAC1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-192 aa of BC004247 Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL 相同性解析による交差性が予測される生物種 |
| Full Name | ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) |
| Calculated molecular weight | 21 kDa |
| Observed molecular weight | 21 kDa |
| GenBank accession number | BC004247 |
| Gene Symbol | RAC1 |
| Gene ID (NCBI) | 5879 |
| RRID | AB_2881521 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P63000 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
RAC1b, also named as TC25, belongs to the small GTPase superfamily and Rho family. RAC1 is a plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, it binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization and growth-factor induced formation of membrane ruffles.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RAC1 antibody 66122-1-Ig | Download protocol |
| IHC protocol for RAC1 antibody 66122-1-Ig | Download protocol |
| IP protocol for RAC1 antibody 66122-1-Ig | Download protocol |
| WB protocol for RAC1 antibody 66122-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell Targeting the mevalonate pathway suppresses ARID1A-inactivated cancers by promoting pyroptosis | ||
Mol Cell TCR activation directly stimulates PYGB-dependent glycogenolysis to fuel the early recall response in CD8+ memory T cells. | ||
Exp Mol Med Human neuron chimeric mice reveal impairment of DVL-1-mediated neuronal migration by sevoflurane and potential treatment by rTMS | ||
Nat Commun TLR4 signalling via Piezo1 engages and enhances the macrophage mediated host response during bacterial infection. |








