Validation Data Gallery
Tested Applications
Positive WB detected in | A549 cells, HEK-293 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, PC-12 cells, mouse brain tissue, rat brain tissue |
Positive IP detected in | HepG2 cells |
Positive IHC detected in | human renal cell carcinoma tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HEK-293 cells, NIH/3T3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 12 publications below |
WB | See 36 publications below |
IHC | See 10 publications below |
IF | See 11 publications below |
IP | See 2 publications below |
CoIP | See 1 publications below |
Product Information
10495-1-AP targets PIN1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0767 Product name: Recombinant human PIN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC002899 Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 相同性解析による交差性が予測される生物種 |
Full Name | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 |
Calculated molecular weight | 18 kDa |
Observed molecular weight | 18 kDa |
GenBank accession number | BC002899 |
Gene Symbol | PIN1 |
Gene ID (NCBI) | 5300 |
RRID | AB_2163943 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13526 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
• PIN1(Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1) is essential for mitosis progression in yeast cells and is hypothesized to perform the same role in mammalian cells. It might regulate cellular processes distinct from the cell cycle itself, such as terminal differentiation through a modulation of differentiation-specific gene expression(PMID:20801874). It colocalizes with NEK6 in the nucleus. Pin1 inhibition simultaneously blocks multiple cancer pathways, disrupts the desmoplastic and immunosuppressive TME, and upregulates PD-L1 and ENT1, rendering pancreatic ductal adenocarcinoma (PDAC) eradicable by immunochemotherapy (PMID: 34388391).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PIN1 antibody 10495-1-AP | Download protocol |
IHC protocol for PIN1 antibody 10495-1-AP | Download protocol |
IF protocol for PIN1 antibody 10495-1-AP | Download protocol |
IP protocol for PIN1 antibody 10495-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Stabilization of Pin1 by USP34 promotes Ubc9 isomerization and protein sumoylation in glioma stem cells | ||
J Pineal Res Melatonin directly binds and inhibits death-associated protein kinase 1 function in Alzheimer's disease. | ||
J Hazard Mater Cobalt induces neurodegenerative damages through Pin1 inactivation in mice and human neuroglioma cells. | ||
Theranostics SPTBN1 inhibits inflammatory responses and hepatocarcinogenesis via the stabilization of SOCS1 and downregulation of p65 in hepatocellular carcinoma. | ||
Nucleic Acids Res Pin1 promotes GR transactivation by enhancing recruitment to target genes.
| ||
Oxid Med Cell Longev PIN1 Protects Hair Cells and Auditory HEI-OC1 Cells against Senescence by Inhibiting the PI3K/Akt/mTOR Pathway. |