Validation Data Gallery
Tested Applications
| Positive WB detected in | LNCaP cells, HAP1, HSC-T6 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells, Neuro-2a cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HAP1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 4 publications below |
| IF | See 4 publications below |
| IP | See 1 publications below |
Product Information
67390-1-Ig targets Profilin 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29206 Product name: Recombinant human PFN1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-140 aa of BC006768 Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY 相同性解析による交差性が予測される生物種 |
| Full Name | profilin 1 |
| Calculated molecular weight | 140 aa, 15 kDa |
| Observed molecular weight | 13-15 kDa |
| GenBank accession number | BC006768 |
| Gene Symbol | Profilin 1 |
| Gene ID (NCBI) | 5216 |
| RRID | AB_2882634 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P07737 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Profilin-1 (PFN1) plays an important role in the control of actin dynamics, and could represent an important therapeutic target in several diseases. PFN1 is identified as a huntingtin aggregation inhibitor, and may serves as a tumor-suppressor. PFN1 is crucial for the conversion of monomeric (G)-actin to filamentous (F)-actin. Amyotrophic lateral sclerosis (ALS) is a late-onset neurodegenerative disorder resulting from motor neuron death. Cells expressing PFN1 mutants contain ubiquitinated, insoluble aggregates that in many cases contain the ALS-associated protein TDP-43. Recently, PFN1 is a potential biomarker for bladder cancer aggressiveness and may be of great clinical importance.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Profilin 1 antibody 67390-1-Ig | Download protocol |
| IHC protocol for Profilin 1 antibody 67390-1-Ig | Download protocol |
| WB protocol for Profilin 1 antibody 67390-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Prolif An artificial intelligence network-guided signature for predicting outcome and immunotherapy response in lung adenocarcinoma patients based on 26 machine learning algorithms | ||
iScience Methods to separate nuclear soluble fractions reflecting localizations in living cells | ||
Diabetes Metab Syndr Obes Profilin1 Promotes Renal Tubular Epithelial Cell Apoptosis in Diabetic Nephropathy Through the Hedgehog Signaling Pathway | ||
Cell Death Discov Zona pellucida is required for oocyte actin cortex and oocyte-somatic cell interactions during oocyte growth. | ||
J Biol Chem Abnormal regulation of membrane-less organelles contributes to profilin1-associated ALS
| ||
F1000Res The identification of high-performing antibodies for Profilin-1 for use in Western blot, immunoprecipitation and immunofluorescence
|






