Validation Data Gallery
Tested Applications
| Positive IHC detected in | human brain tissue, mouse brain tissue, human pancreas cancer tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue, mouse eye tissue |
| Positive IF-Fro detected in | rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 7 publications below |
| IF | See 4 publications below |
Product Information
12833-1-AP targets Neuropeptide Y in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3568 Product name: Recombinant human NPY protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC029497 Sequence: MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW 相同性解析による交差性が予測される生物種 |
| Full Name | neuropeptide Y |
| Calculated molecular weight | 97 aa, 11 kDa |
| GenBank accession number | BC029497 |
| Gene Symbol | Neuropeptide Y |
| Gene ID (NCBI) | 4852 |
| RRID | AB_10791890 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01303 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Neuropeptide Y (NPY) is one of the most abundant peptides in the mammalian central nervous system (CNS). NPY has been linked to several physiological and pathological functions, such as feeding behaviour, memory processing, pain, anxiety, cell proliferation and many other processes in the central and peripheral nervous systems. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. In addition, NPY was suggested as a potential neuroprotective agent in Alzheimer's disease by counteracting the toxic effect of β-amyloid in an in vitro model.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Neuropeptide Y antibody 12833-1-AP | Download protocol |
| IHC protocol for Neuropeptide Y antibody 12833-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Aging Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer | ||
ACS Appl Mater Interfaces Lithium-Doped Titanium Dioxide-Based Multilayer Hierarchical Structure for Accelerating Nerve-Induced Bone Regeneration | ||
Free Radic Biol Med Inhibition of neuronal nitric oxide synthase protects against hippocampal neuronal injuries by increasing neuropeptide Y expression in temporal lobe epilepsy mice. | ||
J Orthop Translat Suprascapular nerve injury affects rotator cuff healing: A paired controlled study in a rat model. | ||
Front Behav Neurosci Heterogeneous GAD65 Expression in Subtypes of GABAergic Neurons Across Layers of the Cerebral Cortex and Hippocampus. | ||
Acta Neurobiol Exp (Wars) Aberrant changes of somatostatin and neuropeptide Y in brain of a genetic rat model for epilepsy: tremor rat. |













