Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, rat brain tissue, HeLa cells | 
| Positive IP detected in | HeLa cells | 
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:1500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below | 
| WB | See 34 publications below | 
| IHC | See 4 publications below | 
| IF | See 25 publications below | 
| IP | See 5 publications below | 
| CoIP | See 2 publications below | 
| RIP | See 1 publications below | 
Product Information
10556-1-AP targets Nucleolin/C23 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, pig | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag0859 Product name: Recombinant human NCL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-482 aa of BC006494 Sequence: MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE相同性解析による交差性が予測される生物種 | 
| Full Name | nucleolin | 
| Calculated molecular weight | 76 kDa | 
| Observed molecular weight | 100-110 kDa | 
| GenBank accession number | BC006494 | 
| Gene Symbol | NCL | 
| Gene ID (NCBI) | 4691 | 
| RRID | AB_2082423 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P19338 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Nucleolin, also known as C23, involved in the control of transcription of ribosomal RNA (rRNA) genes by RNA polymerase I, in nucleocytoplasmic transportation of ribosomal components, and in ribosome maturation and assembly. It associated with intranucleolar chromatin and pre-ribosomal particles, and induced chromatin decondensation by binding to histione H1. Also it has a role in the process of transcriptional elongation. Whilst mammalian nucleolin has a predicted molecular mass of approximately 77 kDa, the apparent molecular mass is between 100 and 110 kDa, and has been attributed to the amino acid composition of the N-terminal domain, which is highly phosphorylated. (PMID: 15925566)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Nucleolin/C23 antibody 10556-1-AP | Download protocol | 
| IHC protocol for Nucleolin/C23 antibody 10556-1-AP | Download protocol | 
| IP protocol for Nucleolin/C23 antibody 10556-1-AP | Download protocol | 
| WB protocol for Nucleolin/C23 antibody 10556-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Mol Cell Aberrant phase separation drives membranous organelle remodeling and tumorigenesis | ||
| Neuron Antisense Proline-Arginine RAN Dipeptides Linked to C9ORF72-ALS/FTD Form Toxic Nuclear Aggregates that Initiate In Vitro and In Vivo Neuronal Death. | ||
| Genome Res The nuclear matrix protein HNRNPU maintains 3D genome architecture globally in mouse hepatocytes. | ||
| Clin Transl Med LncRNA BC promotes lung adenocarcinoma progression by modulating IMPAD1 alternative splicing
 | ||
| Protein Cell Nuclear m6A reader YTHDC1 regulates the scaffold function of LINE1 RNA in mouse ESCs and early embryos. | 





