Validation Data Gallery
Tested Applications
| Positive WB detected in | Caco-2 cells, mouse colon tissue, rat colon tissue, HeLa cells |
| Positive IHC detected in | human liver cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
| Positive IF/ICC detected in | MCF-7 cells, C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 14 publications below |
| IHC | See 3 publications below |
| IF | See 4 publications below |
| IP | See 1 publications below |
Product Information
15354-1-AP targets MYL9 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7600 Product name: Recombinant human MYL9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002648 Sequence: MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD 相同性解析による交差性が予測される生物種 |
| Full Name | myosin, light chain 9, regulatory |
| Calculated molecular weight | 20 kDa |
| Observed molecular weight | 20 kDa |
| GenBank accession number | BC002648 |
| Gene Symbol | MYL9 |
| Gene ID (NCBI) | 10398 |
| RRID | AB_2147773 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24844 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Myosin regulatory light polypeptide 9 (MYL9), also known as MLC2, belongs to the myosin regulatory subunits. It plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation at Thr19 and Ser20. Implicated in cytokinesis, receptor capping, and cell locomotion (PMID:11942626, PMID:2526655). Some studies have demonstrated that MYL9 may play important roles in various human cancers. The expression and phosphorylation of MYL9 (Thr19/Ser20) may be increased in human breast (PMID: 22144583) and liver cancers (PMID: 18648664), while decreased in human colon (PMID: 22752057) and bladder cancers (PMID: 21139803). MYL9 was the only gene differentially expressed in the aged versus young injured arteries in the rat smooth muscle cell layers (PMID:22003410).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MYL9 antibody 15354-1-AP | Download protocol |
| IHC protocol for MYL9 antibody 15354-1-AP | Download protocol |
| WB protocol for MYL9 antibody 15354-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metabolite-gated vascular contractility switch: OXGR1 activation mechanism enables agonist therapy for rosacea erythema. | ||
Blood Targeting STK17B kinase activates ferroptosis and suppresses drug resistance in multiple myeloma. | ||
Cancer Res Transfer of Damaged Mitochondria from Cancer Cells to Cancer-Associated Fibroblasts Promotes Tyrosine Kinase Inhibitor Tolerance in EGFR-Mutant Lung Cancer. | ||
Nat Commun Single-cell transcriptomics reveals aberrant skin-resident cell populations and identifies fibroblasts as a determinant in rosacea | ||
Sci Adv RNA binding protein DDX3X drives pancreatic cancer progression via the TLE2-MYL9 axis. | ||
Cell Death Dis Inhibition of Rho GEFs attenuates pulmonary fibrosis through suppressing myofibroblast activation and reprogramming profibrotic macrophages |












