Validation Data Gallery
Tested Applications
| Positive WB detected in | SH-SY5Y cells, rat brain tissue, mouse brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, mouse brain tissue |
| Positive IF-Fro detected in | mouse brain tissue, rat brain tissue |
| Positive IF/ICC detected in | iPS cells |
| Positive FC (Intra) detected in | Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 112 publications below |
| IHC | See 49 publications below |
| IF | See 297 publications below |
Product Information
17490-1-AP targets MAP2 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11580 Product name: Recombinant human MAP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 213-559 aa of BC038857 Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL 相同性解析による交差性が予測される生物種 |
| Full Name | microtubule-associated protein 2 |
| Calculated molecular weight | 200 kDa |
| Observed molecular weight | 280 kDa, 70-85 kDa |
| GenBank accession number | BC038857 |
| Gene Symbol | MAP2 |
| Gene ID (NCBI) | 4133 |
| RRID | AB_2137880 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11137 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Microtubule-associated protein 2 (MAP2) is a tubulin binding protein regulating the spacing and stability of microtubules and contributing to elongation of dendrites.
What is the molecular weight of MAP2? Is MAP2 post-translationally modified?
MAP2 has multiple isoforms that arise from alternative splicing (PMID: 3121794, 7854050, and 10383434). They are classified into two groups - MAP2A and MAP2B, which are known as high molecular weight (HMW) isoforms, run as ~280 kDa species, while low molecular weight (LMW) isoforms MAP2C and MAP2D are around ~70 kDa. MAP2 proteins are heavily phosphorylated, which contributes to a large discrepancy between their predicted and observed molecular weight in SDS-PAGE (220 vs 280 kDa for HMW forms).
What is the tissue expression pattern of MAP2? What is the subcellular localization of MAP2?
MAP2 isoforms differ in their tissue and developmental expression pattern (PMID: 2469170 and 3898077). In the brain, MAP2B is widely expressed during and post development, MAP2A is expressed postnatally, while MAP2C is present only in the early development except of present in photosensitive cells of the adult retina and in the olfactory system. MAP proteins are highly expressed in the CNS found in cell bodies and dendrites of neurons, in dorsal root ganglion, reactive glia, and in the testis (PMID: 9588626). In neurons, MAP2 proteins are found in the cell body and dendrites, where they associate with microtubules, while they can also be present in the nuclei of testicular cells.
Can MAP2 be used as a neuronal marker?
MAP2 proteins are abundantly expressed in neurons. MAP2 is frequently used as a dendritic marker because it is present in the cell body and dendrites of neurons but absent in axons (PMID: 28413822).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MAP2 antibody 17490-1-AP | Download protocol |
| IF protocol for MAP2 antibody 17490-1-AP | Download protocol |
| IHC protocol for MAP2 antibody 17490-1-AP | Download protocol |
| IP protocol for MAP2 antibody 17490-1-AP | Download protocol |
| WB protocol for MAP2 antibody 17490-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Social memory maintenance relies on social interaction-induced proteolytic products of neuroligin 1. | ||
Cell Metab Astrocytic LRP1 enables mitochondria transfer to neurons and mitigates brain ischemic stroke by suppressing ARF1 lactylation | ||
Adv Mater Polyphenol Mediated Assembly: Tailored Nano-Dredger Unblocks Axonal Autophagosomes Retrograde Transport Traffic Jam for Accelerated Alzheimer's Waste Clearance | ||
Adv Mater Flexible Living Artificial Dura Mater for Efficient Therapy of Central Nervous System Injury Based on Neuronal Differentiation and Neuroprotective A2 Astrocyte Activation. |