Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, human brain tissue, human testis tissue, Jurkat cells, MCF-7 cells, T-47D cells, MDA-MB-453s cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human breast cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 20 publications below |
| IHC | See 7 publications below |
| IF | See 10 publications below |
| ChIP | See 1 publications below |
Product Information
10060-1-AP targets FKBPL in WB, IHC, IF, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0112 Product name: Recombinant human FKBPL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-237 aa of BC004168 Sequence: ETPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRAL 相同性解析による交差性が予測される生物種 |
| Full Name | FK506 binding protein like |
| Calculated molecular weight | 349 aa, 38 kDa |
| Observed molecular weight | 42-48 kDa |
| GenBank accession number | BC004168 |
| Gene Symbol | FKBPL |
| Gene ID (NCBI) | 63943 |
| RRID | AB_2262677 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UIM3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
FKBPL, also named as DIR1, NG7 and WISp39, has similarity to the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBPL levels may be a prognostic indicator and determinant of response to endocrine therapy(PMID:20103631, 15664193). It can be detected the band between 38 kDa and 48 kDa by western blot.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FKBPL antibody 10060-1-AP | Download protocol |
| IP protocol for FKBPL antibody 10060-1-AP | Download protocol |
| WB protocol for FKBPL antibody 10060-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Adv Res Hsa_circ_0001402 alleviates vascular neointimal hyperplasia through a miR-183-5p-dependent regulation of vascular smooth muscle cell proliferation, migration, and autophagy | ||
Cancer Res FKBPL regulates estrogen receptor signaling and determines response to endocrine therapy. | ||
Cell Mol Life Sci A placenta-on-a-chip model to determine the regulation of FKBPL and galectin-3 in preeclampsia | ||
J Control Release Delivery of RALA/siFKBPL nanoparticles via electrospun bilayer nanofibres: An innovative angiogenic therapy for wound repair.
| ||
Clin Cancer Res FKBPL and peptide derivatives: novel biological agents that inhibit angiogenesis by a CD44-dependent mechanism. | ||
Oncogene Identification of RBCK1 as a novel regulator of FKBPL: implications for tumor growth and response to tamoxifen. |










