Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, human brain tissue, pig brain tissue, rat brain tissue, mouse brain tissue |
| Positive IP detected in | rat brain tissue |
| Positive IHC detected in | human lung cancer tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
66061-1-Ig targets 14-3-3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6055 Product name: Recombinant human 14-3-3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-245 aa of BC056867 Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN 相同性解析による交差性が予測される生物種 |
| Full Name | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide |
| Calculated molecular weight | 28 kDa |
| Observed molecular weight | 31 kDa, 28 kDa |
| GenBank accession number | BC056867 |
| Gene Symbol | 14-3-3 theta |
| Gene ID (NCBI) | 10971 |
| RRID | AB_11042772 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P27348 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
14-3-3 proteins interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for 14-3-3 antibody 66061-1-Ig | Download protocol |
| IHC protocol for 14-3-3 antibody 66061-1-Ig | Download protocol |
| IP protocol for 14-3-3 antibody 66061-1-Ig | Download protocol |
| WB protocol for 14-3-3 antibody 66061-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Aging (Albany NY) In vitro and in vivo efficacy of the novel oral proteasome inhibitor NNU546 in multiple myeloma. | ||
Neurosci Res HAP1 interacts with 14-3-3 to regulate epileptic seizure via GABAAR-mediated inhibitory synaptic transmission in pentylenetetrazole rat model. | ||
Cell Rep Liquid-liquid phase separation of EphB4 drives pulmonary hypertension via YAP activation. | ||
J Virol The African swine fever virus MGF360-16R protein functions as a mitochondrial-dependent apoptosis inducer by competing with BAX to bind to the HSP60 protein | ||
Clin Nutr Ceramide enhanced the hepatic glucagon response through regulation of CREB activity |






