Validation Data Gallery
Tested Applications
| Positive WB detected in | MCF-7 cells, U-87 MG cells |
| Positive IHC detected in | human lung cancer tissue, mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse embryo tissue |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 15 publications below |
| IHC | See 7 publications below |
| IF | See 2 publications below |
Product Information
26757-1-AP targets LIF in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25076 Product name: Recombinant human LIF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 27-202 aa of BC093733 Sequence: ITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF 相同性解析による交差性が予測される生物種 |
| Full Name | leukemia inhibitory factor (cholinergic differentiation factor) |
| Calculated molecular weight | 202 aa, 22 kDa |
| Observed molecular weight | 22 kDa, 32 kDa |
| GenBank accession number | BC093733 |
| Gene Symbol | LIF |
| Gene ID (NCBI) | 3976 |
| RRID | AB_2880624 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15018 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
LIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. LIF is a glycoprotein with variable molecular weight (38-67 kDa) due to differential glycosylation. (PMID: 8262236, PMID: 35204717)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LIF antibody 26757-1-AP | Download protocol |
| IHC protocol for LIF antibody 26757-1-AP | Download protocol |
| WB protocol for LIF antibody 26757-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Stem Cell LIF signaling regulates outer radial glial to interneuron fate during human cortical development | ||
Toxicology Toxicity mechanism of peri-implantation pesticide beta-cypermethrin exposure on endometrial remodeling in early pregnant mice | ||
Hum Reprod The depot GnRH agonist protocol improves the live birth rate per fresh embryo transfer cycle, but not the cumulative live birth rate in normal responders: a randomized controlled trial and molecular mechanism study. | ||
Int J Cancer Leukemia inhibitory factor is a novel biomarker to predict lymph node and distant metastasis in pancreatic cancer. | ||
Reprod Biol Endocrinol Expression and significance of miR-30d-5p and SOCS1 in patients with recurrent implantation failure during implantation window | ||
Reproduction Consistency and synchronization of AMPK-glycogen in endometrial epithelial cells are critical to the embryo implantation. |







