Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse heart tissue |
| Positive IHC detected in | mouse brain tissue, rat brain tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 21 publications below |
| IHC | See 2 publications below |
| IF | See 7 publications below |
Product Information
21774-1-AP targets CACNA1C in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16455 Product name: Recombinant human L-VOCC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1835-2135 aa of BC146846 Sequence: EVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPVPTLRLEGVESSEKLNSSFPSIHCGSWAETTPGGGGSSAARRVRPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL 相同性解析による交差性が予測される生物種 |
| Full Name | calcium channel, voltage-dependent, L type, alpha 1C subunit |
| Calculated molecular weight | 249 kDa |
| Observed molecular weight | 249 kDa |
| GenBank accession number | BC146846 |
| Gene Symbol | CACNA1C |
| Gene ID (NCBI) | 775 |
| RRID | AB_2878918 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13936 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Calcium voltage-gated channel subunit alpha1 C (CACNA1C, also known as CACH2 and Cav1.2) couples transient activation of inward calcium current to transcriptional regulation and plays an important role in dendritic development, neuronal survival, synaptic plasticity, memory formation, learning, and behavior (PMID: 21248242; 16251435; 20169575; 19047462; 18174367). Genetic variation in CACNA1C has also been associated with depression, schizophrenia, and autism spectrum disorders, as well as changes in brain function and structure in control subjects who have no diagnosable psychiatric illness (PMID: 22705413).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CACNA1C antibody 21774-1-AP | Download protocol |
| IF protocol for CACNA1C antibody 21774-1-AP | Download protocol |
| IHC protocol for CACNA1C antibody 21774-1-AP | Download protocol |
| WB protocol for CACNA1C antibody 21774-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Protective role and mechanism of snakegourd peel against myocardial infarction in rats. | ||
Antioxid Redox Signal Anthracycline-induced atrial structural and electrical remodeling characterizes early cardiotoxicity and contributes to atrial conductive instability and dysfunction. | ||
Front Immunol Interleukin-6-Mediated-Ca2+ Handling Abnormalities Contributes to Atrial Fibrillation in Sterile Pericarditis Rats. | ||
Reprod Biol Endocrinol In vitro fertilization with frozen embryo transfer increased histamine-mediated contractile sensitivity via PKCβ in human umbilical vein | ||
Mol Nutr Food Res Quercetin Attenuates Ethanol-Induced Iron Uptake and Myocardial Injury by Regulating the Angiotensin II-L-Type Calcium Channel. | ||
Commun Biol Cytosolic peptides encoding CaV1 C-termini downregulate the calcium channel activity-neuritogenesis coupling. |









