Validation Data Gallery
Tested Applications
| Positive WB detected in | rat adrenal gland tissue, SH-SY5Y cells |
| Positive IHC-Autostainer detected in | human colorectal cancer tissue, human stomach cancer tissue, human pituitary adenoma tissue, human appendicitis tissue |
| Positive IHC detected in | human pancreas cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human pancreas cancer tissue |
| Positive IF/ICC detected in | Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:3000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 2 publications below |
| IF | See 7 publications below |
Product Information
60135-2-Ig targets Chromogranin A in WB, IHC, IHC-Autostainer, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, sheep |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0807 Product name: Recombinant human CHGA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 158-457 aa of BC006459 Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG 相同性解析による交差性が予測される生物種 |
| Full Name | chromogranin A (parathyroid secretory protein 1) |
| Calculated molecular weight | 51 kDa |
| Observed molecular weight | 70-75 kDa |
| GenBank accession number | BC006459 |
| Gene Symbol | Chromogranin A |
| Gene ID (NCBI) | 1113 |
| RRID | AB_2918358 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P10645 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Chromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Chromogranin A antibody 60135-2-Ig | Download protocol |
| IHC protocol for Chromogranin A antibody 60135-2-Ig | Download protocol |
| WB protocol for Chromogranin A antibody 60135-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer | ||
Stem Cell Res Ther Expansion of mouse castration-resistant intermediate prostate stem cells in vitro | ||
Front Microbiol Tongbian decoction restores intestinal microbiota and activates 5-hydroxytryptamine signaling: implication in slow transit constipation | ||
Chem Biol Interact Evaluation of intestinal toxicity of polystyrene micro/nanoplastics using intestinal organoids. | ||
Cancer Lett SNHG18 deficiency reprograms arginine metabolism to foster an immunosuppressive microenvironment in prostate cancer bone metastasis. | ||
Cell Tissue Res Neurotoxic stimulation alters prosaposin levels in the salivary systems of rats |



















