Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, rat brain tissue, mouse brain tissue, pig brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | rat colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells, MDCK cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:950-1:3800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1112 publications below |
| IHC | See 2 publications below |
| IF | See 7 publications below |
| IP | See 3 publications below |
| CoIP | See 2 publications below |
Product Information
81115-1-RR targets Beta Actin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, canine, monkey, chicken, bovine, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14521 Product name: Recombinant human beta actin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC002409 Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 相同性解析による交差性が予測される生物種 |
| Full Name | actin, beta |
| Calculated molecular weight | 375 aa, 42 kDa |
| Observed molecular weight | 42 kDa |
| GenBank accession number | BC002409 |
| Gene Symbol | Beta Actin |
| Gene ID (NCBI) | 60 |
| RRID | AB_2923704 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P60709 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 )
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Beta Actin antibody 81115-1-RR | Download protocol |
| IHC protocol for Beta Actin antibody 81115-1-RR | Download protocol |
| IP protocol for Beta Actin antibody 81115-1-RR | Download protocol |
| WB protocol for Beta Actin antibody 81115-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res Nonenzymatic lysine D-lactylation induced by glyoxalase II substrate SLG dampens inflammatory immune responses | ||
Adv Mater Ultrasound Imaging of Tumor Vascular CD93 with MMRN2 Modified Microbubbles for Immune Microenvironment Prediction | ||
Cell Metab Lighting up arginine metabolism reveals its functional diversity in physiology and pathology | ||
ACS Nano Long Noncoding RNA URB1-Antisense RNA 1 (AS1) Suppresses Sorafenib-Induced Ferroptosis in Hepatocellular Carcinoma by Driving Ferritin Phase Separation | ||
Nat Commun A nanoemulsion targeting adipose hypertrophy and hyperplasia shows anti-obesity efficiency in female mice |






