Validation Data Gallery
Tested Applications
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse ovary tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IHC | See 5 publications below |
| IF | See 13 publications below |
| IP | See 1 publications below |
| CoIP | See 2 publications below |
Product Information
21279-1-AP targets ZP3 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15791 Product name: Recombinant human ZP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC113949 Sequence: MVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAF 相同性解析による交差性が予測される生物種 |
| Full Name | zona pellucida glycoprotein 3 (sperm receptor) |
| Calculated molecular weight | 373 aa, 41 kDa |
| Observed molecular weight | 47 kDa, 60 kDa |
| GenBank accession number | BC113949 |
| Gene Symbol | ZP3 |
| Gene ID (NCBI) | 7784 |
| RRID | AB_11124319 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21754 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Zona pellucida (ZP) is an extracellular matrix that surrounds the oocyte and early embryo, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. Mammalian ZP consists of three to four glycoproteins, called ZP1, ZP2, ZP3, ZP4. ZP3 (zona pellucida glycoprotein 3, also known as zona pellucida sperm-binding protein 3) is essential for sperm binding and zona matrix formation. Human ZP3 gene encodes predicted precursor protein of 47 kDa that is processed into mature glycoprotein with larger apparent molecular mass (PMID: 8588935; 10341000).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ZP3 antibody 21279-1-AP | Download protocol |
| IHC protocol for ZP3 antibody 21279-1-AP | Download protocol |
| IP protocol for ZP3 antibody 21279-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Differ Transglutaminase 2 crosslinks zona pellucida glycoprotein 3 to prevent polyspermy. | ||
Am J Hum Genet A Recurrent Missense Mutation in ZP3 Causes Empty Follicle Syndrome and Female Infertility. | ||
Fertil Steril The critical role of ZP genes in female infertility characterized by empty follicle syndrome and oocyte degeneration. | ||
Hum Reprod Identification of a heterozygous variant of ZP2 as a novel cause of empty follicle syndrome in humans and mice. | ||
Cell Discov Abnormal gametogenesis induced by p53 deficiency promotes tumor progression and drug resistance. | ||
Hum Mutat A novel gene mutation in ZP3 loop region identified in patients with empty follicle syndrome |






