Validation Data Gallery
Tested Applications
| Positive WB detected in | U-937 cells, 3T3-L1 cells, RAW 264.7 cells, HeLa cells | 
| Positive IHC detected in | rat ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 4 publications below | 
| IHC | See 2 publications below | 
| IF | See 4 publications below | 
Product Information
12306-1-AP targets ZFP36L1/2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag2952 Product name: Recombinant human ZFP36L1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-338 aa of BC018340 Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD 相同性解析による交差性が予測される生物種 | 
                                    
| Full Name | zinc finger protein 36, C3H type-like 1 | 
| Calculated molecular weight | 338 aa, 36 kDa | 
| Observed molecular weight | 45-50 kDa | 
| GenBank accession number | BC018340 | 
| Gene Symbol | ZFP36L1 | 
| Gene ID (NCBI) | 677 | 
| RRID | AB_2737443 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q07352 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
ZFP36L1, also named as Butyrate response factor 1 or TPA-induced sequence 11b, is a 338 amino acid protein, which is phosphorylated by RPS6KA1 at Ser-334 upon phorbol 12-myristate 13-acetate (PMA) treatment. ZFP36 encodes tristetraprolin (TTP) the prototype of a small family of RBPs, called the ZFP36 family, that are characterised by highly conserved tandem CCCH zinc-finger RNA-binding domains [PMID: 10751406]. ZFP36 is a RBP that promotes RNA decay and negatively regulates the expression of the myogenic regulatory factor MyoD by binding to the 3'UTR of MyoD mRNA [PMID: 25815583]. Mouse satellite cells from Zfp36-deficient mice express increased amounts of MyoD and display impaired satellite activation, demonstrating a role for ZFP36 in the maintenance of quiescence [PMID: 25815583]. The functions of the ZFP36L1 and ZFP36L2 family members have not been evaluated in skeletal muscle stem cell fate, but have been shown to act redundantly to promote quiescence during lymphocyte development. ZFP36L1 has been implicated in the persistence of the marginal zone B lymphocyte population. ZFP36L1 exists three isoform through blasting on NCBI database and can be phosphorylated, so the range of the molecular weight of ZFP36L1 is about 40-50 kDa. (PMID: 26180518, PMID: 17030620). This antibody recognizes both ZFP36L1 and ZFP36L2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ZFP36L1/2 antibody 12306-1-AP | Download protocol | 
| IHC protocol for ZFP36L1/2 antibody 12306-1-AP | Download protocol | 
| WB protocol for ZFP36L1/2 antibody 12306-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Cell A Membraneless Organelle Associated with the Endoplasmic Reticulum Enables 3'UTR-Mediated Protein-Protein Interactions. | ||
Mol Ther Nucleic Acids The miR-93-3p/ZFP36L1/ZFX axis regulates keratinocyte proliferation and migration during skin wound healing.
  | ||
Cell Death Dis ZFP36L2 regulates myocardial ischemia/reperfusion injury and attenuates mitochondrial fusion and fission by LncRNA PVT1. | ||
J Clin Invest EMT-activated secretory and endocytic vesicular trafficking programs underlie a vulnerability to PI4K2A antagonism in lung cancer
  | ||
Elife HUWE1 controls tristetraprolin proteasomal degradation by regulating its phosphorylation | ||
Heliyon BRF1 promotes the odontogenic differentiation of dental pulp stem cells in pulpitis by inducing autophagy | 








