Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, MDA-MB-231 cells | 
| Positive IP detected in | HEK-293 cells | 
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below | 
| WB | See 14 publications below | 
| IHC | See 5 publications below | 
| IF | See 2 publications below | 
| IP | See 2 publications below | 
| CoIP | See 1 publications below | 
| RIP | See 2 publications below | 
Product Information
29441-1-AP targets YTHDC1 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag31459 Product name: Recombinant human YTHDC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC053863 Sequence: MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVDRRASRSSQSSKEEVNSEEYG相同性解析による交差性が予測される生物種 | 
| Full Name | YTH domain containing 1 | 
| Calculated molecular weight | 85 kDa | 
| Observed molecular weight | ~100 kDa | 
| GenBank accession number | BC053863 | 
| Gene Symbol | YTHDC1 | 
| Gene ID (NCBI) | 91746 | 
| RRID | AB_2918307 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q96MU7 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
YTHDC1, containing 1 YTH domain, is one of the m6A-binding proteins that can recognize and bind to the m6A methylation site and plays a specific role in gene expression. YTHDC1 is constitutively enriched in the nucleus. It regulates mRNA splicing by bridging the interactions between the trans- and cis-regulatory elements to bind targeted mRNAs. YTHDC1 mediates the export of m6A modified mRNA from the nucleus to the cytoplasm by interacting with SRSF3, which is an essential factor driving the tumorigenic process in various types of cancers including breast cancer, colon cancer, ovarian cancer, osteosarcoma, and glioblastoma (32368386).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for YTHDC1 antibody 29441-1-AP | Download protocol | 
| IP protocol for YTHDC1 antibody 29441-1-AP | Download protocol | 
| WB protocol for YTHDC1 antibody 29441-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Cancer Cell Int YTHDC1-mediated VPS25 regulates cell cycle by targeting JAK-STAT signaling in human glioma cells.
 | ||
| J Clin Lab Anal Mettl3 promotes oxLDL-mediated inflammation through activating STAT1 signaling. | ||
| Nanoscale Res Lett RNA m6A Alterations Induced by Biomineralization Nanoparticles: A Proof-of-Concept Study of Epitranscriptomics for Nanotoxicity Evaluation. | ||
| Discov Oncol Systematic analysis of the expression profile and prognostic significance of m6A regulators and PD-L1 in hepatocellular carcinoma | ||
| Cell Stem Cell Decoding m6A RNA methylome identifies PRMT6-regulated lipid transport promoting AML stem cell maintenance | ||
| Exp Mol Med The YTHDC1/GLUT3/RNF183 axis forms a positive feedback loop that modulates glucose metabolism and bladder cancer progression
 | 










