Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, HEK-293 cells, Jurkat cells, Raji cells |
| Positive IHC detected in | human breast cancer tissue, mouse liver tissue, human colon cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 16 publications below |
| IHC | See 3 publications below |
| ChIP | See 1 publications below |
Product Information
24168-1-AP targets XBP1S/XBP1U in WB, IHC, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21454 Product name: Recombinant human XBP1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-167 aa of BC000938 Sequence: MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAAL 相同性解析による交差性が予測される生物種 |
| Full Name | X-box binding protein 1 |
| Calculated molecular weight | 261 aa, 29 kDa |
| Observed molecular weight | ~32 kDa; ~60 kDa |
| GenBank accession number | BC000938 |
| Gene Symbol | XBP1 |
| Gene ID (NCBI) | 7494 |
| RRID | AB_2879445 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P17861 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
XBP1 is also named as XBP2, belongs to the bZIP family. The X-box-binding protein-1 (XBP1) is a transcriptional regulator of the ER stress response that lies downstream of inositol-requiring enzyme 1 (IRE1α) activation (PMID: 14559994). IRE1α possesses both kinase and ribonuclease activity and processes XBP1 mRNA to produce an active transcription factor in response to ER stress (PMID: 11779464, 11780124). It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum, the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1. The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1S, which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1U, is constitutively expressed, and thought to function as a negative feedback regulator of XBP1S, which shuts off transcription of target genes during the recovery phase of ER stress (PMID: 11850408). The unspliced XBP1U isoform is composed of 261 amino acid residues, and the spliced XBP1S isoform is composed of 376 amino acid residues. The XBP1 antibody (24168-1-AP) can detect both XBP1U and XBP1S.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for XBP1S/XBP1U antibody 24168-1-AP | Download protocol |
| IHC protocol for XBP1S/XBP1U antibody 24168-1-AP | Download protocol |
| WB protocol for XBP1S/XBP1U antibody 24168-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Hazard Mater GRP78/IRE1 and cGAS/STING pathway crosstalk through CHOP facilitates iodoacetic acid-mediated testosterone decline | ||
J Ethnopharmacol Network pharmacology, molecular docking, and in vitro experimental verification of the mechanism of Guanxining in treating diabetic atherosclerosis | ||
Bioorg Chem Dihydroartemisinin alleviates steatosis and inflammation in nonalcoholic steatohepatitis by decreasing endoplasmic reticulum stress and oxidative stress. | ||
J Virol Inositol requiring enzyme 1α promotes Zika virus infection through regulating stearoyl-CoA desaturase 1 mediated lipid metabolism.
| ||
Exp Ther Med Apelin‑13 reduces high glucose‑induced mitochondrial dysfunction in cochlear hair cells by inhibiting endoplasmic reticulum stress | ||
J Zhejiang Univ Sci B Endoplasmic reticulum stress is involved in retinal injury induced by repeated transient spikes of intraocular pressure |













