Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, NIH/3T3 cells, HSC-T6 cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 27 publications below |
| IHC | See 2 publications below |
| IF | See 10 publications below |
| IP | See 3 publications below |
| CoIP | See 2 publications below |
Product Information
12197-1-AP targets WWP2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2835 Product name: Recombinant human WWP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-355 aa of BC013645 Sequence: MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRT 相同性解析による交差性が予測される生物種 |
| Full Name | WW domain containing E3 ubiquitin protein ligase 2 |
| Calculated molecular weight | 870 aa, 99 kDa |
| Observed molecular weight | 110-115 kDa |
| GenBank accession number | BC013645 |
| Gene Symbol | WWP2 |
| Gene ID (NCBI) | 11060 |
| RRID | AB_10597536 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00308 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
WWP2(WW domain-containing protein 2) is also named as AIP2 and belongs to the NEDD4-like protein family. It functions as an E3 ubiquitin ligase for PTEN that plays a vital role in tumour-cell survival and is also involved in regulating transcription, embryonic stem-cell fate, cellular transport and T-cell activation processes(PMID:21532586).WWP2, which specifically interacted with ES cell-specific transcription factor Oct-4 and promoted its ubiquitination both in vitro and in vivo, is a ubiquitously expressed protein and exists in both cytoplasmic and nuclear compartments in ES cells(PMID:15047715).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for WWP2 antibody 12197-1-AP | Download protocol |
| IP protocol for WWP2 antibody 12197-1-AP | Download protocol |
| WB protocol for WWP2 antibody 12197-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Differ Endothelial cells-derived SEMA3G suppresses glioblastoma stem cells by inducing c-Myc degradation | ||
Adv Sci (Weinh) Ubiquitination of NS1 Confers Differential Adaptation of Zika Virus in Mammalian Hosts and Mosquito Vectors | ||
Cardiovasc Diabetol Down-regulation of WWP2 aggravates Type 2 diabetes mellitus-induced vascular endothelial injury through modulating ubiquitination and degradation of DDX3X
| ||
Cell Death Differ Selective targeting of ubiquitination and degradation of PARP1 by E3 ubiquitin ligase WWP2 regulates isoproterenol-induced cardiac remodeling.
| ||
Redox Biol Role of WW domain E3 ubiquitin protein ligase 2 in modulating ubiquitination and Degradation of Septin4 in oxidative stress endothelial injury. | ||
Br J Pharmacol Costunolide represses hepatic fibrosis through WWP2-mediated Notch3 degradation. |



