Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue, MCF-7 cells |
| Positive IHC detected in | rat brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 13 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
Product Information
27214-1-AP targets WNT2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25845 Product name: Recombinant human WNT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 231-270 aa of BC029854 Sequence: GDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVY 相同性解析による交差性が予測される生物種 |
| Full Name | wingless-type MMTV integration site family member 2 |
| Calculated molecular weight | 40 kDa |
| Observed molecular weight | 34-40 kDa |
| GenBank accession number | BC029854 |
| Gene Symbol | WNT2 |
| Gene ID (NCBI) | 7472 |
| RRID | AB_2880804 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09544 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Wnt2 is a secreted glycoprotein that is one of the canonical Wnt ligands. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt2 is known to directly regulate β-catenin activity, the key player in proliferation and inflammation. Recently, studies have demonstrated that Wnt2 is overexpressed in various human cancers, including esophageal, gastric, colorectal, breast, lung, cervical, and malignant glioma.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for WNT2 antibody 27214-1-AP | Download protocol |
| IF protocol for WNT2 antibody 27214-1-AP | Download protocol |
| IHC protocol for WNT2 antibody 27214-1-AP | Download protocol |
| WB protocol for WNT2 antibody 27214-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Kidney Int Non-canonical Wnt/calcium signaling is protective against podocyte injury and glomerulosclerosis | ||
Nat Ecol Evol Single-cell analysis of the amphioxus hepatic caecum and vertebrate liver reveals genetic mechanisms of vertebrate liver evolution | ||
Phytother Res Capsaicin suppressed activity of prostate cancer stem cells by inhibition of Wnt/β-catenin pathway. | ||
Clin Transl Med Ursodesoxycholic acid alleviates liver fibrosis via proregeneration by activation of the ID1-WNT2/HGF signaling pathway. | ||
Cell Rep Dynamic interplay between IL-1 and WNT pathways in regulating dermal adipocyte lineage cells during skin development and wound regeneration | ||
Biomed Pharmacother Evidence for Wnt signaling's central involvement in perinatal nicotine exposure-induced offspring lung pathology and its modulation by electroacupuncture |