Recombinant human WFDC1 protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Powder

Publications

2

Cat no : Ag3960

Synonyms

WFDC1, Prostate stromal protein ps20, PS20, ps20 growth inhibitor, WAP four-disulfide core domain protein 1



Product Information

Peptide Sequence ALPARLAEKSRAEEAGAPGGPRQPRADRCPPPPRTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ
(38-220 aa encoded by BC029159)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Purity85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Formulation The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.

Reconstitution and Storage

Reconstitution Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Stability and Storage Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage of Reconstituted Protein Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.

Publications

SpeciesTitle

Br J Cancer

Expression of two WFDC1/ps20 isoforms in prostate stromal cells induces paracrine apoptosis through regulation of PTGS2/COX-2.

Authors - Oliver J Hickman

Biochem Biophys Rep

Cathepsin-L and transglutaminase dependent processing of ps20: A novel mechanism for ps20 regulation via ECM cross-linking.

Authors - Oliver J Hickman
||
New chat

Able

正在加载,请稍候...