Validation Data Gallery
Tested Applications
Positive WB detected in | HEK-293 cells, rat skeletal muscle tissue, mouse skeletal muscle, Jurkat cells, U-87 cells |
Positive IP detected in | mouse skeletal muscle tissue |
Positive IHC detected in | human colon tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 5 publications below |
WB | See 10 publications below |
IHC | See 1 publications below |
Product Information
13676-1-AP targets WDR1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4670 Product name: Recombinant human WDR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC030541 Sequence: MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG 相同性解析による交差性が予測される生物種 |
Full Name | WD repeat domain 1 |
Calculated molecular weight | 606 aa, 66 kDa |
Observed molecular weight | 66-70 kDa |
GenBank accession number | BC030541 |
Gene Symbol | WDR1 |
Gene ID (NCBI) | 9948 |
RRID | AB_10697831 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75083 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
WDR1, which belongs to the WD repeat AIP1 family, also known as AIP1, is a 606 amino acid protein that localizes to the cytoskeleton. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WDR1 induces the disassembly of actin filaments in conjunction with ADF/cofilin family proteins (PMID:15629458, 27557945, 29751004). WDR1 mutations may impair the ability of WDR1 to regulate cofilin-mediated actin depolymerization, and are associated with periodic fever, immunodeficiency, and thrombocytopenia syndrome (PMID: 27557945,27994071,29751004).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for WDR1 antibody 13676-1-AP | Download protocol |
IHC protocol for WDR1 antibody 13676-1-AP | Download protocol |
IP protocol for WDR1 antibody 13676-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Death Dis AIP1-mediated actin disassembly is required for postnatal germ cell migration and spermatogonial stem cell niche establishment. | ||
J Biol Chem Trp-Asp (WD) repeat domain 1 is Essential for Mouse Peri-implantation Development and Regulates Cofilin Phosphorylation. | ||
Am J Pathol A Cardiomyocyte-Specific Wdr1 Knockout Demonstrates Essential Functional Roles for Actin Disassembly during Myocardial Growth and Maintenance In Mice.
| ||
Mol Cells WD Repeat Domain 1 Deficiency Inhibits Neointima Formation in Mice Carotid Artery by Modulation of Smooth Muscle Cell Migration and Proliferation.
| ||
Int J Biol Sci WDR1 Promotes Cell Growth and Migration and Contributes to Malignant Phenotypes of Non-small Cell Lung Cancer through ADF/cofilin-mediated Actin Dynamics.
| ||
Dev Biol WDR1-regulated actin dynamics is required for outflow tract and right ventricle development.
|