Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, human liver tissue, mouse skeletal muscle tissue, K-562 cells, U2OS cells, BxPC-3 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 4 publications below |
| IHC | See 1 publications below |
Product Information
12946-1-AP targets VRK2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4019 Product name: Recombinant human VRK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC027854 Sequence: MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDVKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVN 相同性解析による交差性が予測される生物種 |
| Full Name | vaccinia related kinase 2 |
| Calculated molecular weight | 508 aa, 58 kDa |
| Observed molecular weight | 50 kDa |
| GenBank accession number | BC027854 |
| Gene Symbol | VRK2 |
| Gene ID (NCBI) | 7444 |
| RRID | AB_2215681 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86Y07 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Vaccinia-related kinase 2 (VRK2) is a serine/threonine kinase that plays a significant role in various cellular processes, including cell survival, proliferation, and DNA damage response. The VRK2 gene is known to produce two main splice variants: VRK2A and VRK2B, with VRK2A being the predominant form in humans. VRK2 is involved in several key biological functions. It is known to enhance cell survival by acting as an anti-apoptotic factor, which is particularly crucial in cancer biology. The overexpression of VRK2 has been linked to increased drug sensitivity in cancer cells, suggesting that this kinase may play a role in therapeutic responses. Additionally, high levels of VRK2 protein have been associated with improved survival rates in specific subgroups of astrocytomas, a type of brain tumor. (PMID: 29872222; 37943248; 24079673)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for VRK2 antibody 12946-1-AP | Download protocol |
| IP protocol for VRK2 antibody 12946-1-AP | Download protocol |
| WB protocol for VRK2 antibody 12946-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Oncogene β-Trcp and CK1δ-mediated degradation of LZTS2 activates PI3K/AKT signaling to drive tumorigenesis and metastasis in hepatocellular carcinoma. | ||
Int J Biol Sci VRK2 activates TNFα/NF-κB signaling by phosphorylating IKKβ in pancreatic cancer. | ||
BMC Med Reduced Vrk2 expression is associated with higher risk of depression in humans and mediates depressive-like behaviors in mice
| ||
Cell Rep Elevated FBXW10 drives hepatocellular carcinoma tumorigenesis via AR-VRK2 phosphorylation-dependent GAPDH ubiquitination in male transgenic mice
|





