Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, K-562 cells, RAW264.7, HepG2 cells, Jurkat cells |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below |
| WB | See 13 publications below |
| IHC | See 3 publications below |
| IF | See 5 publications below |
| IP | See 2 publications below |
| CoIP | See 3 publications below |
Product Information
12490-1-AP targets USP3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3085 Product name: Recombinant human USP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC018113 Sequence: MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK 相同性解析による交差性が予測される生物種 |
| Full Name | ubiquitin specific peptidase 3 |
| Calculated molecular weight | 520 aa, 59 kDa |
| Observed molecular weight | 53-59 kDa |
| GenBank accession number | BC018113 |
| Gene Symbol | USP3 |
| Gene ID (NCBI) | 9960 |
| RRID | AB_10639042 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y6I4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
USP3(Ubiquitin carboxyl-terminal hydrolase 3) belongs to the peptidase C19 family. It may regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. USP3 is implicated as a novel chromatin modifier in the maintenance of genome integrity. This protein has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for USP3 antibody 12490-1-AP | Download protocol |
| IHC protocol for USP3 antibody 12490-1-AP | Download protocol |
| IF protocol for USP3 antibody 12490-1-AP | Download protocol |
| IP protocol for USP3 antibody 12490-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Differ N6-methyladenosine-modified USP13 induces pro-survival autophagy and imatinib resistance via regulating the stabilization of autophagy-related protein 5 in gastrointestinal stromal tumors | ||
EMBO J A stress-induced tyrosine-tRNA depletion response mediates codon-based translational repression and growth suppression. | ||
BMC Med Downregulation of AC092894.1 promotes oxaliplatin resistance in colorectal cancer via the USP3/AR/RASGRP3 axis | ||
Cell Death Dis USP3 promotes DNA damage response and chemotherapy resistance through stabilizing and deubiquitinating SMARCA5 in prostate cancer
| ||
Cell Rep Increased degradation of FMRP contributes to neuronal hyperexcitability in tuberous sclerosis complex | ||
BMC Cancer Protein deubiquitylase USP3 stabilizes Aurora A to promote proliferation and metastasis of esophageal squamous cell carcinoma.
|








