Recombinant human ULBP2 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag3798
Synonyms
ULBP2, ALCAN alpha, ALCAN-alpha, N2DL2, N2DL-2
Validation Data Gallery
Product Information
| Peptide Sequence |
AGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRA
(25-224 aa encoded by BC034689) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
