Validation Data Gallery
Tested Applications
| Positive WB detected in | K-562 cells, mouse brain tissue, mouse lung tissue, Jurkat cells, NIH/3T3 cells, C6 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human thyroid cancer tissue, human kidney tissue, mouse lung tissue, rat liver tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 13 publications below |
| IHC | See 2 publications below |
| IF | See 6 publications below |
| IP | See 4 publications below |
Product Information
10344-1-AP targets UBE3A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0346 Product name: Recombinant human UBE3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 9-215 aa of BC002582 Sequence: GEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSS 相同性解析による交差性が予測される生物種 |
| Full Name | ubiquitin protein ligase E3A |
| Calculated molecular weight | 852 aa, 98 kDa |
| Observed molecular weight | 100 kDa |
| GenBank accession number | BC002582 |
| Gene Symbol | UBE3A |
| Gene ID (NCBI) | 7337 |
| RRID | AB_2211801 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q05086 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
UBE3A(Ubiquitin-protein ligase E3A) is also named as E6AP, EPVE6AP, HPVE6A and belongs to the E3 ubiquitin protein ligase family. It functions as both an E3 ligase in the ubiquitin proteasome pathway and as a transcriptional coactivator. It is also initially identified as a cellular protein that mediates in vitro association of the human papillomavirus E6 protein with p53, leading to the ubiquitin-dependent degradation of p53(PMID:1661671). Defects in UBE3A are a cause of Angelman syndrome (AS)(PMID:10508479). It has 3 isoforms with MW of 97-101 kDa produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for UBE3A antibody 10344-1-AP | Download protocol |
| IHC protocol for UBE3A antibody 10344-1-AP | Download protocol |
| IP protocol for UBE3A antibody 10344-1-AP | Download protocol |
| WB protocol for UBE3A antibody 10344-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Mol Cell Biol Landscape of genomic imprinting and its functions in the mouse mammary gland. | ||
Oncogene Celastrol recruits UBE3A to recognize and degrade the DNA binding domain of steroid receptors
| ||
Cell Death Discov SNORD6 promotes cervical cancer progression by accelerating E6-mediated p53 degradation | ||
Int J Biol Sci UBE3A activates the NOTCH pathway and promotes esophageal cancer progression by degradation of ZNF185.
| ||
Mol Neurobiol All-Trans Retinoic Acid Exerts Neuroprotective Effects in Amyotrophic Lateral Sclerosis-Like Tg (SOD1*G93A)1Gur Mice. |













