Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 14 publications below |
| IHC | See 8 publications below |
| IF | See 4 publications below |
| CoIP | See 1 publications below |
Product Information
12134-2-AP targets UBE2C in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2780 Product name: Recombinant human UBE2C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC016292 Sequence: MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP 相同性解析による交差性が予測される生物種 |
| Full Name | ubiquitin-conjugating enzyme E2C |
| Calculated molecular weight | 179 aa, 20 kDa |
| Observed molecular weight | 20 kDa |
| GenBank accession number | BC016292 |
| Gene Symbol | UBE2C |
| Gene ID (NCBI) | 11065 |
| RRID | AB_2212191 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00762 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
UBE2C(Ubiquitin-conjugating enzyme E2 C) is also known as UBCH10 and belongs to the ubiquitin-conjugating enzyme family. It is highly expressed in a variety of human primary tumors, and it is able to promote cell proliferation and malignant transformation (PMID:18703417). UBE2C, along with the E3 ligase of the anaphasepromoting complex (APC), catalyzes the ubiquitination of mitotic cyclins A and B, as well as securin. UBE2C is essential for cell cycle progression, and mutation of its active site cysteine confers a dominant-negative phenotype(PMID:17217624).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UBE2C antibody 12134-2-AP | Download protocol |
| IP protocol for UBE2C antibody 12134-2-AP | Download protocol |
| WB protocol for UBE2C antibody 12134-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Lett UBE2C Mediates Follicular Thyroid Carcinoma Invasion and Metastasis via K29-Specific Vimentin Ubiquitination
| ||
Plant Cell SINAT E3 Ubiquitin Ligases Mediate FREE1 and VPS23A Degradation to Modulate Abscisic Acid Signaling. | ||
Arterioscler Thromb Vasc Biol Disturbed Flow Increases UBE2C (Ubiquitin E2 Ligase C) via Loss of miR-483-3p, Inducing Aortic Valve Calcification by the pVHL (von Hippel-Lindau Protein) and HIF-1α (Hypoxia-Inducible Factor-1α) Pathway in Endothelial Cells. | ||
Cell Biosci DNA primase subunit 1 deteriorated progression of hepatocellular carcinoma by activating AKT/mTOR signaling and UBE2C-mediated P53 ubiquitination. | ||
J Biol Chem The Transcription factor NF-YA is Crucial for Neural Progenitor Maintenance during Brain Development | ||
Biomed Pharmacother Affinity-based protein profiling to reveal targets of puerarin involved in its protective effect on cardiomyocytes. |



