Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HEK-293T cells, HEK-293 cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human endometrial cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 6 publications below |
| WB | See 33 publications below |
| IHC | See 9 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
15047-1-AP targets Thymidylate synthase in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7027 Product name: Recombinant human TYMS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC002567 Sequence: MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV 相同性解析による交差性が予測される生物種 |
| Full Name | thymidylate synthetase |
| Calculated molecular weight | 36 kDa |
| Observed molecular weight | 32-36 kDa |
| GenBank accession number | BC002567 |
| Gene Symbol | TYMS |
| Gene ID (NCBI) | 7298 |
| RRID | AB_2210721 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04818 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Thymidylate synthase gene (TYMS) encodes thymidylate synthase (TS) which is an important factor in the growth of tumor cells. TS can catalyze the transformation of intracellular uridine monophosphate (dump) into dTMP which is required for DNA replication and repairing. TS is a key enzyme in the process of cell proliferation, also is the important target enzymes of 5-FU and other chemotherapy drugs. The expression of TYMS is negatively correlated with the efficacy of chemotherapy and the prognosis of patients who suffer from rectal cancer, breast cancer, colorectal cancer, gastric cancer, head and neck cancer, esophageal cancer, pancreatic cancer and so on.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Thymidylate synthase antibody 15047-1-AP | Download protocol |
| IHC protocol for Thymidylate synthase antibody 15047-1-AP | Download protocol |
| IP protocol for Thymidylate synthase antibody 15047-1-AP | Download protocol |
| WB protocol for Thymidylate synthase antibody 15047-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Metab Salvage of ribose from uridine or RNA supports glycolysis in nutrient-limited conditions
| ||
Cancer Res 5-Fluorouracil Enhances the Antitumor Activity of the Glutaminase Inhibitor CB-839 against PIK3CA-Mutant Colorectal Cancers. | ||
Nat Commun CETSA screening identifies known and novel thymidylate synthase inhibitors and slow intracellular activation of 5-fluorouracil. | ||
Cell Discov Lysine butyrylation of HSP90 regulated by KAT8 and HDAC11 confers chemoresistance | ||
Redox Biol Redistribution of defective mitochondria-mediated dihydroorotate dehydrogenase imparts 5-fluorouracil resistance in colorectal cancer |







