Validation Data Gallery
Tested Applications
| Positive WB detected in | HSC-T6 cells, A549 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 14 publications below |
| IF | See 2 publications below |
Product Information
67728-1-Ig targets TXNRD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30071 Product name: Recombinant human TXNRD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 199-500 aa of BC018122 Sequence: SYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG 相同性解析による交差性が予測される生物種 |
| Full Name | thioredoxin reductase 1 |
| Calculated molecular weight | 55 kDa |
| Observed molecular weight | 50-70 kDa |
| GenBank accession number | BC018122 |
| Gene Symbol | TXNRD1 |
| Gene ID (NCBI) | 7296 |
| RRID | AB_2882914 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q16881 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Thioredoxin reductase-1 (TXNRD1) is uniquely capable of utilizing electrons from NADPH to recover the reduced state of TRX1. Interestingly, TXNRD1 is upregulated in many human malignancies and promotes cancer progression, and attenuation of TXNRD1 levels effectively suppresses the growth of tumor cells (PMID: 31384178). TXNRD1 is also upregulated in many human malignancies and functions as a prognostic factor for many tumors, such as oral squamous cell carcinomas, lung cancer, breast cancer, and astrocytomas. TXNRD1 protein levels were analyzed by inmmunoblotting. Bands of ~55 kDa for TXNRD1 were observed. IHC analysis suggested TXNRD1 was mainly located in the cytoplasm. (PMID: 28536696, PMID: 20584310)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TXNRD1 antibody 67728-1-Ig | Download protocol |
| IHC protocol for TXNRD1 antibody 67728-1-Ig | Download protocol |
| WB protocol for TXNRD1 antibody 67728-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer | ||
Redox Biol Guiding bar motif of thioredoxin reductase 1 modulates enzymatic activity and inhibitor binding by communicating with the co-factor FAD and regulating the flexible C-terminal redox motif | ||
Redox Biol Mecheliolide elicits ROS-mediated ERS driven immunogenic cell death in hepatocellular carcinoma. | ||
J Immunother Cancer Nanoparticle delivery of miR-21-3p sensitizes melanoma to anti-PD-1 immunotherapy by promoting ferroptosis. | ||
Front Oncol Bioinformatics-Driven Identification of p62 as A Crucial Oncogene in Liver Cancer. | ||
Front Oncol A Robust Metabolic Enzyme-Based Prognostic Signature for Head and Neck Squamous Cell Carcinoma.
|




