Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, K562 cells, MCF-7 cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human liver cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:9000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 10 publications below |
| WB | See 98 publications below |
| IHC | See 10 publications below |
| IF | See 12 publications below |
| IP | See 7 publications below |
| ELISA | See 1 publications below |
| CoIP | See 4 publications below |
Product Information
14999-1-AP targets Thioredoxin 1 in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6989 Product name: Recombinant human TXN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC003377 Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 相同性解析による交差性が予測される生物種 |
| Full Name | thioredoxin |
| Calculated molecular weight | 12 kDa |
| Observed molecular weight | 12 kDa |
| GenBank accession number | BC003377 |
| Gene Symbol | TXN |
| Gene ID (NCBI) | 7295 |
| RRID | AB_2272597 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10599 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Thioredoxin 1 (TXN), also known as TRDX, TRX, TRX1, ADF, and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity. (PMID: 14691207; 16408020; 11118054; 35885063).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Thioredoxin 1 antibody 14999-1-AP | Download protocol |
| IHC protocol for Thioredoxin 1 antibody 14999-1-AP | Download protocol |
| IP protocol for Thioredoxin 1 antibody 14999-1-AP | Download protocol |
| WB protocol for Thioredoxin 1 antibody 14999-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Discov Spatial Transcriptomics of Intraductal Papillary Mucinous Neoplasms of the Pancreas Identifies NKX6-2 as a Driver of Gastric Differentiation and Indolent Biological Potential | ||
Nat Commun Cordycepin prevents radiation ulcer by inhibiting cell senescence via NRF2 and AMPK in rodents. | ||
Nat Commun PDK4 drives abdominal aortic aneurysm by promoting smooth muscle cell metabolic reprogramming and NLRP3-mediated pyroptosis. | ||
Ageing Res Rev Thioredoxin-1 inhibits the activation of IRE1 by targeting Hsp90/p-Cdc37 chaperone complex in Parkinson disease
| ||
Theranostics TFE3, a potential therapeutic target for Spinal Cord Injury via augmenting autophagy flux and alleviating ER stress. | ||
Genes Dis Role of thioredoxin-interacting protein in mediating endothelial dysfunction in hypertension |