Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, Transfected HEK-293 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue, human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 9 publications below |
| IHC | See 3 publications below |
| IF | See 17 publications below |
Product Information
15176-1-AP targets Gamma Tubulin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7070 Product name: Recombinant human tubulin-gamma protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 103-451 aa of BC000619 Sequence: NWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ 相同性解析による交差性が予測される生物種 |
| Full Name | tubulin, gamma 1 |
| Calculated molecular weight | 51 kDa |
| Observed molecular weight | 50-55 kDa |
| GenBank accession number | BC000619 |
| Gene Symbol | Gamma Tubulin |
| Gene ID (NCBI) | 7283 |
| RRID | AB_2878113 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23258 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IF protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IHC protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| IP protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| WB protocol for Gamma Tubulin antibody 15176-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun INTS13 variants causing a recessive developmental ciliopathy disrupt assembly of the Integrator complex | ||
PLoS Biol Noncoding RNA Ginir functions as an oncogene by associating with centrosomal proteins. | ||
Cell Death Differ Haploinsufficiency of GCP4 induces autophagy and leads to photoreceptor degeneration due to defective spindle assembly in retina. | ||
Br J Pharmacol NL13, a novel curcumin analogue and polo like kinase 4 inhibitor, induces cell cycle arrest and apoptosis in prostate cancer models | ||
Elife LUZP1, a novel regulator of primary cilia and the actin cytoskeleton, is a contributing factor in Townes-Brocks Syndrome. |








