Validation Data Gallery
Tested Applications
| Positive WB detected in | DU 145 cells, HEK-293 cells, MCF-7 cells, HeLa cells |
| Positive IP detected in | DU 145 cells |
| Positive IHC detected in | human breast cancer tissue, human kidney tissue, human liver cancer tissue, human testis tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 5 publications below |
| IHC | See 5 publications below |
| IF | See 4 publications below |
Product Information
10381-1-AP targets TTK in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0405 Product name: Recombinant human TTK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 536-789 aa of BC000633 Sequence: SSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHP 相同性解析による交差性が予測される生物種 |
| Full Name | TTK protein kinase |
| Calculated molecular weight | 97 kDa |
| Observed molecular weight | 96-97 kDa |
| GenBank accession number | BC000633 |
| Gene Symbol | TTK |
| Gene ID (NCBI) | 7272 |
| RRID | AB_2211979 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P33981 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Mps1 family of kinases colocalizes with mitotic checkpoint proteins in kinetochores and/or spindle pole bodies/centrosomes. TTK has been shown to be a cell cycle-regulated kinase displaying maximum activity during M phase(PMID:15618221). Its kinase activity is required for proper chromosome segregation during mitosis through its involvements in microtubule-chromosome attachment error correction and the mitotic checkpoint(PMID:20937696). TTK mRNA is present at relatively high levels in testis and thymus, tissues which contain a large number of proliferating cells, but is not detected in most other benign tissues (PMID:1639825). It has 2 isoforms produced by alternative splicing (PMID:25137017).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TTK antibody 10381-1-AP | Download protocol |
| IF protocol for TTK antibody 10381-1-AP | Download protocol |
| IHC protocol for TTK antibody 10381-1-AP | Download protocol |
| IP protocol for TTK antibody 10381-1-AP | Download protocol |
| WB protocol for TTK antibody 10381-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Cell Biol PP6 regulation of Aurora A-TPX2 limits NDC80 phosphorylation and mitotic spindle size | ||
Oxid Med Cell Longev Oxidative Stress Delays Prometaphase/Metaphase of the First Cleavage in Mouse Zygotes via the MAD2L1-Mediated Spindle Assembly Checkpoint. | ||
J Nanobiotechnology GRP75-driven, cell-cycle-dependent macropinocytosis of Tat/pDNA-Ca2+ nanoparticles underlies distinct gene therapy effect in ovarian cancer. | ||
Int J Cancer Development and validation of a five-gene model to predict postoperative brain metastasis in operable lung adenocarcinoma. | ||
Front Oncol Identification and Validation of Hub Genes Associated with Bladder Cancer by Integrated Bioinformatics and Experimental Assays | ||
Front Mol Biosci Characteristic Analysis of Featured Genes Associated With Stemness Indices in Colorectal Cancer. |
