Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, HepG2 cells, rat brain tissue | 
| Positive IP detected in | mouse brain tissue | 
| Positive IHC detected in | rat brain tissue, human prostate cancer tissue,  rat cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below | 
| WB | See 5 publications below | 
| IHC | See 1 publications below | 
| IP | See 1 publications below | 
Product Information
10786-1-AP targets TRIM9 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, rat, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag1238 Product name: Recombinant human TRIM9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC013414 Sequence: MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVR相同性解析による交差性が予測される生物種 | 
| Full Name | tripartite motif-containing 9 | 
| Calculated molecular weight | 80 kDa | 
| Observed molecular weight | 79 kDa, 90 kDa, 61 kDa | 
| GenBank accession number | BC013414 | 
| Gene Symbol | TRIM9 | 
| Gene ID (NCBI) | 114088 | 
| RRID | AB_2209130 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9C026 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
TRIM9(E3 ubiquitin-protein ligase TRIM9) is also named as RNF91 and belongs to the TRIM/RBCC family. TRIM9 protein is a brain-specific E3 ubiquitin ligase. Importantly, TRIM9 is present in LBs found in DLB and PD, suggesting that TRIM9 not only plays roles in the regulation of neuronal functions, but also participates in the formation or breakdown of abnormal inclusions through its ligase activity and besides the striatum and hippocampus, the highest expression of TRIM9 protein is seen in the frontal, temporal and occipital cortices through the western blot (PMID:20085810). It has been reported that TRIM9 is highly expressed in the cerebral cortex in mouse and human brains and that TRIM9 is decreased in damaged brains in patients who have Parkinson disease and dementia with Lewy bodies(PMID:22337885). It has 3 isoforms with molecular mass of 79, 90 and 61 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TRIM9 antibody 10786-1-AP | Download protocol | 
| IP protocol for TRIM9 antibody 10786-1-AP | Download protocol | 
| WB protocol for TRIM9 antibody 10786-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Neurobiol Dis TRIM9, a novel brain-specific E3 ubiquitin ligase, is repressed in the brain of Parkinson's disease and dementia with Lewy bodies. | ||
| Mol Med Rep Knockdown of TRIM9 attenuates irinotecan‑induced intestinal mucositis in IEC‑6 cells by regulating DUSP6 expression via the P38 pathway.
 | ||
| Springerplus Promoter methylation of TRIM9 as a marker for detection of circulating tumor DNA in breast cancer patients. | ||
| Elife A twin UGUA motif directs the balance between gene isoforms through CFIm and the mTORC1 signaling pathway | ||
| Mol Biol Cell The E3 ubiquitin ligase TRIM9 regulates synaptic function and actin dynamics in response to netrin-1
 | 










