Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, mouse small intestine tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human kidney tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 9 publications below |
| IHC | See 2 publications below |
| IF | See 5 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
20356-1-AP targets TRIM2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14208 Product name: Recombinant human TRIM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC011052 Sequence: MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD 相同性解析による交差性が予測される生物種 |
| Full Name | tripartite motif-containing 2 |
| Calculated molecular weight | 744 aa, 82 kDa |
| Observed molecular weight | 70-85 kDa |
| GenBank accession number | BC011052 |
| Gene Symbol | TRIM2 |
| Gene ID (NCBI) | 23321 |
| RRID | AB_10734319 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9C040 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Tripartite motif-containing 2(TRIM2) is an E3 ubiquitin ligase which directs proteasome-mediated degradation of target proteins by the ubiquitination of NEFL and phosphorylation of BCL2L11. This protein contains an N-terminal RING domain, followed by a B-box-2 domain, a coiled-coil region, and 6 C-terminal NHL repeats. TRIM2 involves in the apoptotic response to ischemia via directing degradation of BIM protein, thus has a role in neuroprotection.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRIM2 antibody 20356-1-AP | Download protocol |
| IHC protocol for TRIM2 antibody 20356-1-AP | Download protocol |
| IP protocol for TRIM2 antibody 20356-1-AP | Download protocol |
| WB protocol for TRIM2 antibody 20356-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Divergent self-association properties of paralogous proteins TRIM2 and TRIM3 regulate their E3 ligase activity | ||
J Transl Med Stress-induced epinephrine promotes epithelial-to-mesenchymal transition and stemness of CRC through the CEBPB/TRIM2/P53 axis. | ||
Cancer Cell Int TRIM2 directly deubiquitinates and stabilizes Snail1 protein, mediating proliferation and metastasis of lung adenocarcinoma.
| ||
Commun Biol TRIM2 inhibits apoptosis by ubiquitinating BNIP3 to protect the intestine against ischemia-reperfusion injury in mice | ||
Breast Cancer Res Integrated multi-omics analysis and functional validation reveal the role of TRIM2 as a potential novel biomarker in breast cancer.
| ||
Cell Mol Life Sci E3 ubiquitin ligase TRIM2 identified as a novel suppressor of CYP11B2 and aldosterone production
|








