Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse liver tissue, PC-3 cells, HEK-293 cells, mouse small intestine tissue | 
| Positive IP detected in | mouse liver tissue | 
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below | 
Product Information
15555-1-AP targets TRAPPC3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag7924 Product name: Recombinant human TRAPPC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC007662 Sequence: MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE相同性解析による交差性が予測される生物種 | 
| Full Name | trafficking protein particle complex 3 | 
| Calculated molecular weight | 20 kDa | 
| Observed molecular weight | 20-22 kDa | 
| GenBank accession number | BC007662 | 
| Gene Symbol | TRAPPC3 | 
| Gene ID (NCBI) | 27095 | 
| RRID | AB_2208142 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O43617 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
TRAPPC3 (trafficking protein particle complex 3, also known as Bet3) is a component of TRAPP, a complex involved in the tethering of transport vesicles to the cis-Golgi membrane. There are three TRAPP complexes identified in yeast with distinct roles: TRAPPI in ER-Golgi traffic, TRAPPII in intra-Golgi and endosome-Golgi traffic, and TRAPPIII in autophagy. Recently it has been proposed that at least two complexes exist in mammals. TRAPPC3 is the most conserved subunit of TRAPP and has been used to precipitate the intact tethering complex both from yeast and from human cells. It has also been reported that TRAPPC3 is required for Rabin8 centrosome trafficking and ciliogenesis. Expressed ubiquitously, TRAPPC3 protein is present in both membrane-bound and cytosolic forms. This antibody recognizes the endogenous 20-22 kDa TRAPPC3 in multiple cell lines. (15728249, 21273506, 23394947)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRAPPC3 antibody 15555-1-AP | Download protocol | 
| IHC protocol for TRAPPC3 antibody 15555-1-AP | Download protocol | 
| IP protocol for TRAPPC3 antibody 15555-1-AP | Download protocol | 
| WB protocol for TRAPPC3 antibody 15555-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Cell A systematic mammalian genetic interaction map reveals pathways underlying ricin susceptibility. | ||
| Proc Natl Acad Sci U S A Primary cilia membrane assembly is initiated by Rab11 and transport protein particle II (TRAPPII) complex-dependent trafficking of Rabin8 to the centrosome. | ||
| Int J Biol Sci Defective neurite elongation and branching in Nibp/Trappc9 deficient zebrafish and mice | ||
| J Biol Chem The C7orf43/TRAPPC14 component links the TRAPPII complex to RABIN8 for preciliary vesicle tethering at the mother centriole during ciliogenesis. | ||
| Signal Transduct Target Ther RING finger 138 deregulation distorts NF-кB signaling and facilities colitis switch to aggressive malignancy. | ||
| Metabolites Integrating TCGA and Single-Cell Sequencing Data for Hepatocellular Carcinoma: A Novel Glycosylation (GLY)/Tumor Microenvironment (TME) Classifier to Predict Prognosis and Immunotherapy Response | 








