Validation Data Gallery
Tested Applications
| Positive WB detected in | human liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
Product Information
13770-1-AP targets TRAK2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4753 Product name: Recombinant human TRAK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC040668 Sequence: MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDTLFLYENQDWTQSPHQRQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHILSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALRSKACHIKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELVRYQEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRS 相同性解析による交差性が予測される生物種 |
| Full Name | trafficking protein, kinesin binding 2 |
| Calculated molecular weight | 914 aa, 101 kDa |
| Observed molecular weight | 101-106 kDa |
| GenBank accession number | BC040668 |
| Gene Symbol | TRAK2 |
| Gene ID (NCBI) | 66008 |
| RRID | AB_2207961 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60296 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Trafficking kinesin-binding protein 2 (TRAK2) is a member of the TRAK family of kinesin adaptor proteins. In mammals, there are two members of the TRAK family, TRAK1 and TRAK2 (PMID: 25653102). TRAK1 and TRAK2 play roles in lysosomal and mitochondrial trafficking in cells. They function as kinesin adaptors linking kinesin heavy chain (KHC) to mitochondria (PMID: 28364549). TRAK2 has been found to act as a trafficking factor for the K+ channel Kir2.1 and γ-Aminobutyric acid type A (GABAA) receptor (PMID: 16895905; 24122114).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| IHC protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| IP protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| WB protocol for TRAK2 antibody 13770-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Adv ARMC1 partitions between distinct complexes and assembles MIRO with MTFR to control mitochondrial distribution | ||
FASEB J Adaptation of mitochondrial network dynamics and velocity of mitochondrial movement to chronic stress present in fibroblasts derived from patients with sporadic form of Alzheimer's disease. | ||
J Cell Sci Coordination of mitochondrial and cellular dynamics by the actin-based motor Myo19. | ||
Exp Cell Res Antagomirs targeting miR-142-5p attenuate pilocarpine-induced status epilepticus in mice. | ||
Bioeng Transl Med Photobiomodulation augments the effects of mitochondrial transplantation in the treatment of spinal cord injury in rats by facilitating mitochondrial transfer to neurons via Connexin 36 | ||
BMC Cancer CircSLC22A3 inhibits the invasion and metastasis of ESCC via the miR-19b-3p/TRAK2 axis and by reducing the stability of m6A-modified ACSBG1 mRNA |






