Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, zebrafish tissue, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, pig brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells, A549 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:120-1:480 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IF | See 1 publications below |
Product Information
80501-1-RR targets TOM20 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, chicken, zebrafish samples.
| Tested Reactivity | human, mouse, rat, pig, chicken, zebrafish |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag2378 Product name: Recombinant human TOM20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC000882 Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE 相同性解析による交差性が予測される生物種 |
| Full Name | translocase of outer mitochondrial membrane 20 homolog (yeast) |
| Calculated molecular weight | 145 aa, 16 kDa |
| Observed molecular weight | 16 kDa |
| GenBank accession number | BC000882 |
| Gene Symbol | TOM20 |
| Gene ID (NCBI) | 9804 |
| RRID | AB_2918897 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15388 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TOM20, also named as KIAA0016, belongs to the Tom20 family. It is a central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22, TOM20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. TOM20 is characterized as major docking receptors to mediate the recognition by different mechanisms.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TOM20 antibody 80501-1-RR | Download protocol |
| IF protocol for TOM20 antibody 80501-1-RR | Download protocol |
| IHC protocol for TOM20 antibody 80501-1-RR | Download protocol |
| WB protocol for TOM20 antibody 80501-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Pharmacol The mitochondrial protease ClpP is a promising target for multiple myeloma treatment | ||
J Hazard Mater Unveiling the neurotoxic mechanism of amino-functionalized graphene quantum dots: Mitophagy-driven ferroptosis underlies progressive anxiety-like behaviors. | ||
Antioxid Redox Signal m6A-Dependent Upregulation of PFKFB3 Drives Macrophage-Mediated Inflammation in Necrotizing Enterocolitis. | ||
Front Pharmacol Components of Panax ginseng and Rhodiola rosea regulate mitophagy via the SIRT1/3-PGC-1α-NRF2 pathway to improve myocardial ischemia-reperfusion injury. | ||
J Control Release Pomegranate-inspired bionic microgel/periosteum composite harnessing reactive oxygen species for immune-engineered bone regeneration. | ||
MethodsX Purification of murine cortex mitochondria using a modified magnetic bead isolation method. |









