Validation Data Gallery
Tested Applications
| Positive WB detected in | PMA, LPS and Brefeldin A treated THP-1 cells, LPS treated RAW 264.7 cells |
| Positive IF/ICC detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 904 publications below |
| IHC | See 191 publications below |
| IF | See 137 publications below |
| ELISA | See 9 publications below |
Product Information
17590-1-AP targets TNF-alpha in WB, IHC, IF/ICC, ELISA, Cell treatment, Transwell Assay applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, rabbit, zebrafish, sheep, fish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11433 Product name: Recombinant human TNF-a protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC028148 Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL 相同性解析による交差性が予測される生物種 |
| Full Name | tumor necrosis factor (TNF superfamily, member 2) |
| Calculated molecular weight | 233 aa, 26 kDa |
| Observed molecular weight | 26 kDa |
| GenBank accession number | BC028148 |
| Gene Symbol | TNF-alpha |
| Gene ID (NCBI) | 7124 |
| ENSEMBL Gene ID | ENSG00000232810 |
| RRID | AB_2271853 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01375 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, ins resistance, and cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TNF-alpha antibody 17590-1-AP | Download protocol |
| WB protocol for TNF-alpha antibody 17590-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Exploration (Beijing) Targeting eEF1A1 With Baicalein to Block eEF1A1/Prdx4 Interaction for Treating Sepsis-Mediated Lung Injury | ||
Exploration (Beijing) Microglial targeted therapy relieves cognitive impairment caused by Cntnap4 deficiency | ||
Adv Mater Membrane Fusion-Mediated Loading of Therapeutic siRNA into Exosome for Tissue-Specific Application | ||
Adv Mater Dual Single-Atom Engineered NADH Oxidase-Mimic Boosts In Situ NAD(+) Biotransformation for Targeted Myocardial Ischemia/Reperfusion Protection. | ||
Adv Mater Unlocking an Efficient SOD-to-CAT Catalytic Relay in a MOF Nanozyme via Dopamine-Driven Interfacial Nanoreconstruction for Osteoarthritis Therapy. | ||
Bioact Mater Bioengineered platelet nanoplatform enables renal-targeted dexamethasone delivery for chronic nephritis therapy with dual anti-inflammatory/anti-fibrotic effects and minimized systemic toxicity |