Validation Data Gallery
Tested Applications
| Positive WB detected in | RAW 264.7 cells, LPS and Brefeldin A treated RAW 264.7 cells |
| Positive IF/ICC detected in | LPS and Brefeldin A treated RAW 264.7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 18 publications below |
| IHC | See 6 publications below |
| IF | See 2 publications below |
Product Information
26162-1-AP targets TNF-alpha in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24089 Product name: Recombinant mouse Tnfa protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-235 aa of NM-013693 Sequence: MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL 相同性解析による交差性が予測される生物種 |
| Full Name | tumor necrosis factor |
| Observed molecular weight | 17 kDa |
| GenBank accession number | NM-013693 |
| Gene Symbol | TNF-alpha |
| Gene ID (NCBI) | 21926 |
| RRID | AB_3085845 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P06804 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. Mouse and human TNF-alpha share 79% amino acid sequence identity. Unlike human TNF-alpha, the mouse form is glycosylated. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TNF-alpha antibody 26162-1-AP | Download protocol |
| WB protocol for TNF-alpha antibody 26162-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) POSTN-Mediated Interplay of M1 Polarized Macrophage with Tendon-Derived Stem Cells to Drive Traumatic Heterotopic Ossification Formation through PTK7/ATK Signaling | ||
Biochem Biophys Res Commun Uric acid-lowering effect of harpagoside and its protective effect against hyperuricemia-induced renal injury in mice | ||
J Ethnopharmacol HSYA attenuates Inflammation - Necroptosis to ameliorate secondary brain injury after intracerebral hemorrhage. | ||
J Inflamm Res Modified Xi-Jiao-Di-Huang Decoction Alleviates Sepsis via Regulating Macrophage Polarization by Inhibiting the PIM2/NF-κB Pathway | ||
Int Immunopharmacol Neuroprotective mechanisms of A-971432: Targeting S1PR5 to modulate PI3K/Akt and MAPK pathways in cerebral ischemia/reperfusion injury |


