Validation Data Gallery
Tested Applications
| Positive WB detected in | HL-60 cells, HEK-293 cells, HepG2 cells, mouse kidney tissue, mouse spleen tissue, Raji cells, THP-1 cells, HT-29 cells, mouse thymus tissue, C2C12 cells, RAW 264.7 cells, mouse testis tissue |
| Positive IP detected in | mouse spleen tissue |
| Positive IHC detected in | human tonsillitis tissue, rat thymus tissue, mouse thymus tissue, human spleen tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF-Fro detected in | mouse brain tissue |
| Positive IF/ICC detected in | HT-29 cells, human tonsillitis tissue, THP-1 cells |
| Positive FC (Intra) detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 52 publications below |
| WB | See 412 publications below |
| IHC | See 79 publications below |
| IF | See 138 publications below |
| IP | See 14 publications below |
| CoIP | See 9 publications below |
Product Information
19851-1-AP targets TMEM173/STING in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, CoIP, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, bovine, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13921 Product name: Recombinant human TMEM173 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 174-379 aa of BC047779 Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS 相同性解析による交差性が予測される生物種 |
| Full Name | transmembrane protein 173 |
| Calculated molecular weight | 379 aa, 42 kDa |
| Observed molecular weight | 35-40 kDa, 80 kDa |
| GenBank accession number | BC047779 |
| Gene Symbol | STING |
| Gene ID (NCBI) | 340061 |
| RRID | AB_10665370 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86WV6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Stimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines. STING is a 379 amino acid protein with a calculated molecular weight of 42 kDa. It has been observed at 35-40 kDa (PMID: 27324217; 29632140; 30918080), and 70-80 kDa corresponding to the expected size of a STING dimer (PMID: 25790474; 29491158).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TMEM173/STING antibody 19851-1-AP | Download protocol |
| IF protocol for TMEM173/STING antibody 19851-1-AP | Download protocol |
| IHC protocol for TMEM173/STING antibody 19851-1-AP | Download protocol |
| IP protocol for TMEM173/STING antibody 19851-1-AP | Download protocol |
| WB protocol for TMEM173/STING antibody 19851-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature eccDNAs are apoptotic products with high innate immunostimulatory activity
| ||
Nature Tonic prime-boost of STING signalling mediates Niemann-Pick disease type C.
| ||
Science The heme-regulated inhibitor is a cytosolic sensor of protein misfolding that controls innate immune signaling. | ||
Signal Transduct Target Ther TRAF3 activates STING-mediated suppression of EV-A71 and target of viral evasion
| ||
Cancer Cell Mutant p53 suppresses innate immune signaling to promote tumorigenesis.
|


























